DAZL Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85306

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%), Rat (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: HEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFRRSRAMLK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DAZL Antibody - BSA Free

Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306]

Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306]

Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306] - Analysis in human testis and endometrium tissues. Corresponding DAZL RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306]

Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306]

Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306] - Staining of human cerebral cortex, endometrium, prostate and testis using Anti-DAZL antibody NBP1-85306 (A) shows similar protein distribution across tissues to independent antibody NBP1-85307 (B).
Western Blot: DAZL Antibody [NBP1-85306]

Western Blot: DAZL Antibody [NBP1-85306]

Western Blot: DAZL Antibody [NBP1-85306] - Analysis in control (vector only transfected HEK293T lysate) and DAZL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306]

Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306]

Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306]

Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306]

Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306]

Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306]

Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306]

Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306]

Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306] - Staining of human prostate shows no positivity in glandular cells as expected.

Applications for DAZL Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DAZL

DAZL is a RNA-binding protein, which is essential for gametogenesis. Plays a central role during spermatogenesis. May act by binding to the 3'-UTR of mRNA and thereby regulating the translation of key transcripts

Alternate Names

DAZHSPGY-like-autosomal, DAZL1DAZ-like autosomal, DAZLA, deleted in azoospermia-like, Deleted in azoospermia-like 1, germline specific RNA binding protein, MGC26406, spermatogenesis gene on the Y-like autosomal, SPGYLADAZ homolog

Gene Symbol

DAZL

Additional DAZL Products

Product Documents for DAZL Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DAZL Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for DAZL Antibody - BSA Free

Customer Reviews for DAZL Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DAZL Antibody - BSA Free and earn rewards!

Have you used DAZL Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...