DDB1 Antibody (9L8X5)

Novus Biologicals | Catalog # NBP3-16531

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9L8X5 expressed in HEK293
View all DDB1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1041-1140 of human DDB1 (NP_001914.3). TSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DDB1 Antibody (9L8X5)

Western Blot: DDB1 Antibody (9L8X5) [NBP3-16531]

Western Blot: DDB1 Antibody (9L8X5) [NBP3-16531]

Western Blot: DDB1 Antibody (9L8X5) [NBP3-16531] - Western blot analysis of extracts of various cell lines, using DDB1 Rabbit mAb (NBP3-16531) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
DDB1 Antibody (9L8X5)

Immunohistochemistry: DDB1 Antibody (9L8X5) [NBP3-16531] -

Immunohistochemistry: DDB1 Antibody (9L8X5) [NBP3-16531] - Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma tissue using DDB1 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
DDB1 Antibody (9L8X5)

Immunohistochemistry: DDB1 Antibody (9L8X5) [NBP3-16531] -

Immunohistochemistry: DDB1 Antibody (9L8X5) [NBP3-16531] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using DDB1 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
DDB1 Antibody (9L8X5)

Immunohistochemistry: DDB1 Antibody (9L8X5) [NBP3-16531] -

Immunohistochemistry: DDB1 Antibody (9L8X5) [NBP3-16531] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using DDB1 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
DDB1 Antibody (9L8X5)

Immunohistochemistry: DDB1 Antibody (9L8X5) [NBP3-16531] -

Immunohistochemistry: DDB1 Antibody (9L8X5) [NBP3-16531] - Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using DDB1 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
DDB1 Antibody (9L8X5)

Immunohistochemistry: DDB1 Antibody (9L8X5) [NBP3-16531] -

Immunohistochemistry: DDB1 Antibody (9L8X5) [NBP3-16531] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using DDB1 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
DDB1 Antibody (9L8X5)

Immunohistochemistry: DDB1 Antibody (9L8X5) [NBP3-16531] -

Immunohistochemistry: DDB1 Antibody (9L8X5) [NBP3-16531] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using DDB1 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for DDB1 Antibody (9L8X5)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: DDB1

Damage specific DNA binding protein (DDB) functions in nucleotide-excision repair. Its defective activity causes the repair defect in the patients with xeroderma pigmentosum complementation group E (XPE). To test whether the DNA-repair defect in the subset of XPE patients that lack DNA damage-binding activity is caused by a defect in DDB, purified human DDB protein was injected into XPE cells. The injected DDB protein stimulated DNA repair to normal levels in those strains that lacked the DDB activity but did not stimulate repair in cells from XPE patients that contained the activity. These results provided direct evidence that defective DDB activity causes the repair defect in a subset of XPE patients and establishes a role for this activity in nucleotide excision repair in vivo. It remains for mutation analysis to demonstrate whether the defect in XPE patients is in the DDB1 gene or the DDB2 gene.

Long Name

Damage-specific DNA Binding Protein 1

Alternate Names

DDB p127 Subunit, DDBA, UV-DDB 1, XPCE

Gene Symbol

DDB1

Additional DDB1 Products

Product Documents for DDB1 Antibody (9L8X5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DDB1 Antibody (9L8X5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Deubiquitinating Enzymes (DUBs)

Customer Reviews for DDB1 Antibody (9L8X5)

There are currently no reviews for this product. Be the first to review DDB1 Antibody (9L8X5) and earn rewards!

Have you used DDB1 Antibody (9L8X5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies