DDO Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-32684

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MLIPHTYPDTPIHTQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADVVLGFRKMTE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (81%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DDO Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: DDO Antibody [NBP2-32684]

Immunocytochemistry/ Immunofluorescence: DDO Antibody [NBP2-32684]

Immunocytochemistry/Immunofluorescence: DDO Antibody [NBP2-32684] - Staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684]

Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684]

Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684] - Staining of human lymph node.
Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684]

Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684]

Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684]

Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684]

Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684]

Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684]

Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684] - Staining of human stomach shows low expression as expected.
Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684]

Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684]

Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684] - Staining in human kidney and stomach tissues using anti-DDO antibody. Corresponding DDO RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684]

Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684]

Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684] - Staining of human cerebral cortex, colon, lymph node and urinary bladder using Anti-DDO antibody NBP2-32684 (A) shows similar protein distribution across tissues to independent antibody NBP1-85884 (B).
Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684]

Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684]

Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684] - Staining of human colon.
Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684]

Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684]

Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684] - Staining of human urinary bladder.
Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684]

Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684]

Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684] - Staining of human cerebral cortex.

Applications for DDO Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DDO

OXDD (D-aspartate oxidase) is a peroxisomal flavoprotein that selectively catalyzes the oxidative deamination of D-aspartate and its N-methylated derivative, N-methyl D-aspartate. Flavin adenine dinucleotide or 6-hydroxyflavin adenine dinucleotide can serve as the cofactor in this reaction. Two transcript variants encoding different isoforms have been found.

Alternate Names

aspartic oxidase, DASOX, D-aspartate oxidase, DDO-1, DDO-2, EC 1.4.3.1, FLJ45203

Gene Symbol

DDO

Additional DDO Products

Product Documents for DDO Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DDO Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DDO Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DDO Antibody - BSA Free and earn rewards!

Have you used DDO Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...