DDX17 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87262

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human DDX17. Peptide sequence: TSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGY The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DDX17 Antibody - BSA Free

Western Blot: DDX17 Antibody [NBP2-87262]

Western Blot: DDX17 Antibody [NBP2-87262]

Western Blot: DDX17 Antibody [NBP2-87262] - WB Suggested Anti-DDX17 Antibody Titration: 1.25ug/ml. Positive Control: Jurkat cell lysateDDX17 is supported by BioGPS gene expression data to be expressed in Jurkat
Immunohistochemistry-Paraffin: DDX17 Antibody [NBP2-87262]

Immunohistochemistry-Paraffin: DDX17 Antibody [NBP2-87262]

Immunohistochemistry-Paraffin: DDX17 Antibody [NBP2-87262] - Paraffin Embedded Tissue: Human alveolar cell. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X
Immunohistochemistry-Paraffin: DDX17 Antibody [NBP2-87262]

Immunohistochemistry-Paraffin: DDX17 Antibody [NBP2-87262]

Immunohistochemistry-Paraffin: DDX17 Antibody [NBP2-87262] - Paraffin Embedded Tissue: Human Kidney. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X

Applications for DDX17 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DDX17

DDX17 (p72) is a highly related member of the DEAD box family and is an established RNA helicase. It has been implicated in growth regulation and has been shown to be involved in both pre-mRNA and pre-rRNA processing. This protein has also been reported to act as a transcriptional co-activator for estrogen-receptor alpha (ER ) and shown to interact with co-activators p300/CBP and the RNA polymerase II holoenzyme.

Long Name

DEAD Box Protein 17

Alternate Names

p72, RH70

Gene Symbol

DDX17

Additional DDX17 Products

Product Documents for DDX17 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DDX17 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DDX17 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DDX17 Antibody - BSA Free and earn rewards!

Have you used DDX17 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...