DDX52 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-33776
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin
Cited:
Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KFDTRRFSADAARFQIGKRKYDFDSSEVLQGLDFFGNKKSVPGVCGASQTHQKPQNGEKKEESLTERKREQSKKKRKTMTSEIAS
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for DDX52 Antibody - BSA Free
Immunohistochemistry-Paraffin: DDX52 Antibody [NBP2-33776]
Immunohistochemistry-Paraffin: DDX52 Antibody [NBP2-33776] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.Immunohistochemistry: DDX52 Antibody - BSA Free [NBP2-33776] -
DDX52 knockdown inhibits PCa xenograft growth. a The mice were killed at 6 weeks after implanting 22RV1 cells, and the volumes of the xenograft tumors are shown. b Weights of the xenograft tumors in the control and treated groups (Mann–Whitney test, n = 7, error bars represent standard deviations; ***p < 0.001). c Kaplan–Meier plot showing the time of xenograft genesis after implantation (log-rank test; ***p < 0.001). d Examples of tumor xenografts that underwent hematoxylin and eosin (HE) staining and DDX52 and Ki67 immunohistochemical staining (scale bar: 100 μm). e, f The positive cells in random areas in each xenograft section were counted. e DDX52 expression was measured according to the IHC score (Mann–Whitney test, error bars represent standard deviations; **p < 0.01). f Ki67 expression was measured according to the number of positively stained cells (Mann–Whitney test, error bars represent standard deviations; **p < 0.01) Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/34399732), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for DDX52 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Application Notes
Use in WB reported in scientific literature (PMID:34399732). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: DDX52
Alternate Names
ATP-dependent RNA helicase ROK1-like, DEAD (Asp-Glu-Ala-Asp) box polypeptide 52, DEAD box protein 52, EC 3.6.1, HUSSY19, probable ATP-dependent RNA helicase DDX52, ROK1EC 3.6.4.13
Gene Symbol
DDX52
UniProt
Additional DDX52 Products
Product Documents for DDX52 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for DDX52 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for DDX52 Antibody - BSA Free
Customer Reviews for DDX52 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review DDX52 Antibody - BSA Free and earn rewards!
Have you used DDX52 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...