DECR1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85264

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKT

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (83%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DECR1 Antibody - BSA Free

Western Blot: DECR1 Antibody [NBP1-85264]

Western Blot: DECR1 Antibody [NBP1-85264]

Western Blot: DECR1 Antibody [NBP1-85264] - Analysis using Anti-DECR1 antibody NBP1-85264 (A) shows similar pattern to independent antibody NBP1-85263 (B).
Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85264]

Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85264]

Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85264] - Staining of human lymph node.
Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85264]

Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85264]

Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85264] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85264]

Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85264]

Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85264] - Staining of human placenta shows low expression as expected.
Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85264]

Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85264]

Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85264] - Staining in human liver and placenta tissues using anti-DECR1 antibody. Corresponding DECR1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85264]

Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85264]

Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85264] - Staining of human cerebral cortex, liver, lymph node and placenta using Anti-DECR1 antibody NBP1-85264 (A) shows similar protein distribution across tissues to independent antibody NBP1-85265 (B).
Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85264]

Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85264]

Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85264] - Staining of human cerebral cortex.

Applications for DECR1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DECR1

DECR1, also known as 2, 4-dienoyl-CoA reductase, mitochondrial, is a 36 kDa, 335 amino acid protein that catalyzes beta-oxidation in metabolism of unsaturated fatty enoyl-CoA esters with uneven double bonds. Current research is studying the involvement of the protein on diseases and disorders such as arthritis, malaria, dementia, nephropathy, brain disease, tuberculosis, anemia, and cancer. The protein interacts in metabolism, fatty acid biosynthesis, and beta oxidation pathways with other proteins such as HGS, PRKCE, ESR1, PTTG1, and SLC2A4.

Long Name

2,4-Dienoyl CoA Reductase 1, Mitochondrial

Alternate Names

SDR18C1

Gene Symbol

DECR1

Additional DECR1 Products

Product Documents for DECR1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DECR1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for DECR1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DECR1 Antibody - BSA Free and earn rewards!

Have you used DECR1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...