Dectin-1/CLEC7A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55630

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Dectin-1/CLEC7A Antibody - BSA Free

Western Blot: Dectin-1/CLEC7A Antibody [NBP2-55630]

Western Blot: Dectin-1/CLEC7A Antibody [NBP2-55630]

Western Blot: Dectin-1/CLEC7A Antibody [NBP2-55630] - Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunocytochemistry/ Immunofluorescence: Dectin-1/CLEC7A Antibody [NBP2-55630]

Immunocytochemistry/ Immunofluorescence: Dectin-1/CLEC7A Antibody [NBP2-55630]

Immunocytochemistry/Immunofluorescence: Dectin-1/CLEC7A Antibody [NBP2-55630] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.

Applications for Dectin-1/CLEC7A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Dectin-1/CLEC7A

Dectin1 encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. The encoded glycoprotein is a small type II membrane receptor with an extracellular C-type lectin-like domain fold and a cytoplasmic domain with an immunoreceptor tyrosine-based activation motif. It functions as a pattern-recognition receptor that recognizes a variety of beta-1,3-linked and beta-1,6-linked glucans from fungi and plants, and in this way plays a role in innate immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.

Alternate Names

CD369, CLEC7A, CLECSF12, Dectin1

Gene Symbol

CLEC7A

Additional Dectin-1/CLEC7A Products

Product Documents for Dectin-1/CLEC7A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Dectin-1/CLEC7A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Dectin-1/CLEC7A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Dectin-1/CLEC7A Antibody - BSA Free and earn rewards!

Have you used Dectin-1/CLEC7A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies