DEFA6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84281

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DEFA6 Antibody - BSA Free

Immunohistochemistry-Paraffin: DEFA6 Antibody [NBP1-84281] - Analysis in human small intestine and cerebral cortex tissues using NBP1-84281 antibody. Corresponding DEFA6 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: DEFA6 Antibody [NBP1-84281] - Analysis in human small intestine and cerebral cortex tissues using NBP1-84281 antibody. Corresponding DEFA6 RNA-seq data are presented for the same tissues.
Western Blot: DEFA6 Antibody [NBP1-84281]

Western Blot: DEFA6 Antibody [NBP1-84281]

Western Blot: DEFA6 Antibody [NBP1-84281] - Analysis in human small intestine tissue.
Immunohistochemistry-Paraffin: DEFA6 Antibody [NBP1-84281]

Immunohistochemistry-Paraffin: DEFA6 Antibody [NBP1-84281]

Immunohistochemistry-Paraffin: DEFA6 Antibody [NBP1-84281] - Staining of human duodenum shows cytoplasmic positivity in Paneth cells.
Simple Western: DEFA6 Antibody [NBP1-84281]

Simple Western: DEFA6 Antibody [NBP1-84281]

Simple Western: DEFA6 Antibody [NBP1-84281] - Western lane view shows lysates of Ileum stem cells day 9 differentiated and day 12 differentiated, loaded at 0.2 mg/mL. A specific band was detected for DEFA6 at approximately 15 kDa (as indicated) using 4 ug/mL of Rabbit Anti-DEFA6 Polyclonal Antibody (Catalog # NBP1-84281). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
DEFA6 Antibody [NBP1-84281]

DEFA6 Antibody [NBP1-84281]-Staining of human rectum shows no positivity in glandular cells as expected.

DEFA6 Antibody [NBP1-84281]-Staining of human rectum shows no positivity in glandular cells as expected.
DEFA6 Antibody [NBP1-84281]

DEFA6 Antibody [NBP1-84281]-Staining of human cerebral cortex shows no cytoplasmic positivity in neuronal cells as expected.

DEFA6 Antibody [NBP1-84281]-Staining of human cerebral cortex shows no cytoplasmic positivity in neuronal cells as expected.
DEFA6 Antibody - BSA Free Immunohistochemistry-Paraffin: DEFA6 Antibody - BSA Free [NBP1-84281]

Immunohistochemistry-Paraffin: DEFA6 Antibody - BSA Free [NBP1-84281]

Staining of human small intestine shows strong cytoplasmic positivity in Paneth cells.
DEFA6 Antibody - BSA Free Immunohistochemistry-Paraffin: DEFA6 Antibody - BSA Free [NBP1-84281]

Immunohistochemistry-Paraffin: DEFA6 Antibody - BSA Free [NBP1-84281]

Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.

Applications for DEFA6 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:5000 - 1:10000

Immunohistochemistry-Paraffin

1:5000 - 1:10000

Western Blot

0.04-0.4 ug/ml
Application Notes

For IHC-Paraffin, HIER pH 6 retrieval is recommended.
See Simple Western Antibody Database for Simple Western validation: Tested in Ileum stem cells day 9 differentiated and day 12 differentiated, separated by Size, antibody dilution of 4 ug/mL, apparent MW was 15 kDa

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DEFA6

Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 6, is highly expressed in the secretory granules of Paneth cells of the small intestine, and likely plays a role in host defense of human bowel. [provided by RefSeq]

Alternate Names

DEF6HD-6, defensin 6, Defensin, alpha 6, defensin, alpha 6, Paneth cell-specific, defensin-6

Gene Symbol

DEFA6

Additional DEFA6 Products

Product Documents for DEFA6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DEFA6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for DEFA6 Antibody - BSA Free

Customer Reviews for DEFA6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DEFA6 Antibody - BSA Free and earn rewards!

Have you used DEFA6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...