Defensin alpha 5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84282

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all alpha-Defensin 5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Defensin alpha 5 Antibody - BSA Free

Western Blot: Defensin alpha 5 Antibody [NBP1-84282]

Western Blot: Defensin alpha 5 Antibody [NBP1-84282]

Western Blot: Defensin alpha 5 Antibody [NBP1-84282] - Analysis in human small intestine tissue.
Defensin alpha 5 Antibody

Immunohistochemistry-Paraffin: Defensin alpha 5 Antibody [NBP1-84282] -

Immunohistochemistry-Paraffin: Defensin alpha 5 Antibody [NBP1-84282] - Staining of human placenta shows no positivity in trophoblastic cells as expected.
Defensin alpha 5 Antibody

Immunohistochemistry-Paraffin: Defensin alpha 5 Antibody [NBP1-84282] -

Immunohistochemistry-Paraffin: Defensin alpha 5 Antibody [NBP1-84282] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Defensin alpha 5 Antibody

Immunohistochemistry-Paraffin: Defensin alpha 5 Antibody [NBP1-84282] -

Immunohistochemistry-Paraffin: Defensin alpha 5 Antibody [NBP1-84282] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.
Defensin alpha 5 Antibody - BSA Free Immunohistochemistry-Paraffin: Defensin alpha 5 Antibody - BSA Free [NBP1-84282]

Immunohistochemistry-Paraffin: Defensin alpha 5 Antibody - BSA Free [NBP1-84282]

Staining of human small intestine shows strong cytoplasmic positivity in Paneth cells.
Defensin alpha 5 Antibody - BSA Free Immunohistochemistry-Paraffin: Defensin alpha 5 Antibody - BSA Free [NBP1-84282]

Immunohistochemistry-Paraffin: Defensin alpha 5 Antibody - BSA Free [NBP1-84282]

Analysis in human small intestine and placenta tissues using HPA015775 antibody. Corresponding DEFA5 RNA-seq data are presented for the same tissues.
Defensin alpha 5 Antibody - BSA Free Western Blot: Defensin alpha 5 Antibody - BSA Free [NBP1-84282]

Western Blot: Defensin alpha 5 Antibody - BSA Free [NBP1-84282]

Analysis in human small intestine tissue.

Applications for Defensin alpha 5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: alpha-Defensin 5

Defensin alpha 5 (DEFA5) is primarily responsible for host defense. DEFA5 has shown antimicrobial activity and is thought to kill microbes by permeabilizing their plasma membrane. This protein is highly expressed in the secretory granules of Paneth cells of the ileum.

Defensin alpha 5 antibodies are useful tools for bacterial defense studies and human immunology research.

Long Name

Defensin Alpha 5

Alternate Names

DEF5, DEFA5, Defensin alpha 5, HD-5

Gene Symbol

DEFA5

Additional alpha-Defensin 5 Products

Product Documents for Defensin alpha 5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Defensin alpha 5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Defensin alpha 5 Antibody - BSA Free

Customer Reviews for Defensin alpha 5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Defensin alpha 5 Antibody - BSA Free and earn rewards!

Have you used Defensin alpha 5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies