Recombinant Human DEGS1 GST (N-Term) Protein

Novus Biologicals | Catalog # H00008560-P01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Endotoxin Detection
Loading...

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-323 of Human DEGS1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVIFGAYAFGSCINHSMTLAIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPYSISFKRYHMDHHRYLGADGVDVDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPKPITYLEVINTVAQVTFDILIYYFLGIKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

64.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human DEGS1 GST (N-Term) Protein

Recombinant Human DEGS1 Protein [H00008560-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00008560-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: DEGS1

This gene encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor. Two splice variants have been identified. [provided by RefSeq]

Long Name

Sphingolipid delta(4)-desaturase DES1

Alternate Names

DES1, EC 1.14.19.17, EC 5.2.1.-, MIG15, Retinol isomerase

Gene Symbol

DEGS1

Additional DEGS1 Products

Product Documents for Recombinant Human DEGS1 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human DEGS1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human DEGS1 GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human DEGS1 GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human DEGS1 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Recombinant Human DEGS1 GST (N-Term) Protein

Showing  1 - 2 of 2 FAQs Showing All
  • Q: I'm currently using your recombinant degs1 (H00008560-P01) in an enzyme assay, and I need to get the GST tag alone to confirm its activity as a negative control. Since you have 29 GST tags available, I'm not sure which you used for this protein. Can you tell me which one to purchase for a proper control? Also, would it be possible to purchase the vector with this degs1-gst fusion construct?

    A: We distribute H00008560-P01 for Abnova, a company based in Taiwan. Are you looking for an antibody for a GST tag or a recombinant GST tag protein? Abnova considers the protein sequence of their GST tag to be proprietary, and will not release this information, but they do have an antibody specific for their GST tag, MAB0042-M01. Unfortunately, Abnova does not sell the vectors for any of their proteins.

  • Q: We would like to remove the GST fusion from the DEGS1 recombinant purified protein (H00008560-P01). Can you tell us how to do this (protease digest site) and reference any relevant products we can purchase to remove it?

    A: The recombinant protein you are referring to is an Abnova product, a company based in Taiwan. Please see our GST tag removal protocol. They were unable to pinpoint a specific method for GST tag removal being more advantagous to another so I would invite you to visit our website via the link I provided you exploring that option.

  • Q: I'm currently using your recombinant degs1 (H00008560-P01) in an enzyme assay, and I need to get the GST tag alone to confirm its activity as a negative control. Since you have 29 GST tags available, I'm not sure which you used for this protein. Can you tell me which one to purchase for a proper control? Also, would it be possible to purchase the vector with this degs1-gst fusion construct?

    A: We distribute H00008560-P01 for Abnova, a company based in Taiwan. Are you looking for an antibody for a GST tag or a recombinant GST tag protein? Abnova considers the protein sequence of their GST tag to be proprietary, and will not release this information, but they do have an antibody specific for their GST tag, MAB0042-M01. Unfortunately, Abnova does not sell the vectors for any of their proteins.

  • Q: We would like to remove the GST fusion from the DEGS1 recombinant purified protein (H00008560-P01). Can you tell us how to do this (protease digest site) and reference any relevant products we can purchase to remove it?

    A: The recombinant protein you are referring to is an Abnova product, a company based in Taiwan. Please see our GST tag removal protocol. They were unable to pinpoint a specific method for GST tag removal being more advantagous to another so I would invite you to visit our website via the link I provided you exploring that option.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Proteins and Enzymes
Loading...