DENND5B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-31971

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human

Cited:

Mouse, Avian

Predicted:

Mouse (90%). Backed by our 100% Guarantee.

Applications

Validated:

Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Frozen, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DENND5B Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: FIWDFIEKVVAYFETTDQILDNEDDVLIQKSSCKTFCHYVNAINTAPRNIGK

Reactivity Notes

Rat (88%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DENND5B Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: DENND5B Antibody [NBP2-31971]

Immunocytochemistry/ Immunofluorescence: DENND5B Antibody [NBP2-31971]

Immunocytochemistry/Immunofluorescence: DENND5B Antibody [NBP2-31971] - Staining of human cell line U-2 OS shows localization to nucleoli & microtubules. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DENND5B Antibody [NBP2-31971]

Immunohistochemistry-Paraffin: DENND5B Antibody [NBP2-31971]

Immunohistochemistry-Paraffin: DENND5B Antibody [NBP2-31971] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: DENND5B Antibody [NBP2-31971]

Immunohistochemistry-Paraffin: DENND5B Antibody [NBP2-31971]

Immunohistochemistry-Paraffin: DENND5B Antibody [NBP2-31971] - Staining of human testis shows moderate cytoplasmic and membranous positivity in cells in seminiferus ducts.
Immunohistochemistry-Paraffin: DENND5B Antibody [NBP2-31971]

Immunohistochemistry-Paraffin: DENND5B Antibody [NBP2-31971]

Immunohistochemistry-Paraffin: DENND5B Antibody [NBP2-31971] - Staining of human testis shows moderate membranous and cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: DENND5B Antibody [NBP2-31971]

Immunohistochemistry-Paraffin: DENND5B Antibody [NBP2-31971]

Immunohistochemistry-Paraffin: DENND5B Antibody [NBP2-31971] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: DENND5B Antibody [NBP2-31971]

Immunohistochemistry-Paraffin: DENND5B Antibody [NBP2-31971]

Immunohistochemistry-Paraffin: DENND5B Antibody [NBP2-31971] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
DENND5B Antibody - BSA Free

Western Blot: Rabbit Polyclonal DENND5B Antibody [NBP2-31971]

Analysis of DENND5B expression in control and DENND5B‑knockout human adipocyte cells. Primary antibody used at 1:1000 dilution. Image from a verified customer review.

Applications for DENND5B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Knockout Validated

Knockout Validated from a verified customer review.

Western Blot

Validated for Western Blot from a verified customer review.
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 2 reviews rated 4.5 using NBP2-31971 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DENND5B

MGC24039( AAH20855, 1 a.a. - 508 a.a.) full-length recombinant protein with GST.

Alternate Names

DENN domain-containing protein 5B, DENN/MADD domain containing 5B, DKFZp686P1174, FLJ41648, FLJ43333, MGC24039, Rab6IP1-like protein

Gene Symbol

DENND5B

UniProt

Q6ZUT9 (Human)

Additional DENND5B Products

Product Documents for DENND5B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DENND5B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for DENND5B Antibody - BSA Free

Customer Reviews for DENND5B Antibody - BSA Free (2)

4.5 out of 5
2 Customer Ratings
5 Stars
50%
4 Stars
50%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used DENND5B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 2 of 2 reviews Showing All
Filter By:
Clear Filters X
  • western blot
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Cell Culture Samples
    Species: Human
    Verified Customer | Posted 12/16/2025
    Control and knock out cells
    1:1000 dilution worked
    DENND5B Antibody - BSA Free NBP2-31971
    Bio-Techne Response
    This review reflects a new species or application tested on a primary antibody.
  • DENND5B Antibody
    Name: YI HUANG
    Application: Western Blot
    Sample Tested: mouse primary cell
    Species: Mouse
    Verified Customer | Posted 06/19/2020
    6 percent of the gum, mouse cortex, in the region between 130 and 180, concentration about 1:200, consistent with the results in the primary cells.I will send you better pictures later.
    DENND5B Antibody - BSA Free NBP2-31971

There are no reviews that match your criteria.

Showing  1 - 2 of 2 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies