DHPS Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82648

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%), Rat (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QVRGYDFNRGVNYRALLEAFGTTGFQATNFGRAVQQVNAMIEKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLIKC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DHPS Antibody - BSA Free

Western Blot: DHPS Antibody [NBP1-82648]

Western Blot: DHPS Antibody [NBP1-82648]

Western Blot: DHPS Antibody [NBP1-82648] - Analysis in control (vector only transfected HEK293T lysate) and DHPS over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: DHPS Antibody [NBP1-82648]

Immunocytochemistry/ Immunofluorescence: DHPS Antibody [NBP1-82648]

Immunocytochemistry/Immunofluorescence: DHPS Antibody [NBP1-82648] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648]

Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648]

Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648]

Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648]

Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648]

Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648]

Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648] - Staining of human fallopian tube shows moderate cytoplasmic/membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648]

Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648]

Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648] - Staining of human pancreas shows weak cytoplasmic positivity in islets of Langerhans.
DHPS Antibody - BSA Free

Western Blot: DHPS Antibody - BSA Free [NBP1-82648] -

Spermidine supplementation restored hepatic Eif5aH and mitochondrial protein levels in a dietary mouse model of NASH.a–c Western blot and densitometric analysis of hepatic Dhps, Dohh, Eif5aH, and Eif5a in NCD vs. WDF (a), and WDF vs. WDF + Spd (b) mice. The blots in a and b were processed in parallel. Densitometric analysis (c) was first normalized with GAPDH, and then calculated the fold change against WDF (NCD vs WDF, and WDF + Spd vs WDF). (n = 6) (d–f) Western blot and densitometric analysis of Tfam, PGC1 alpha, and mitochondrial proteins in the liver from mice fed with NCD vs. WDF (d), or WDF vs. WDF + Spd (e). The blots in d and e were processed in parallel. Densitometric analysis (f, n = 6) was first normalized with GAPDH, and then calculated the fold change against WDF (NCD vs WDF, and WDF + Spd vs WDF). (g, h) Mitochondrial DNA copy number (g) and circulating beta -hydroxybutyrate (h) in NCD (n = 6), WDF (n = 6), and WDF + Spd (n = 6) groups. Significance was calculated by one-way ANOVA or Kruskal–Wallis test, as appropriate. Source data are provided as a Source Data file. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36057633), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
DHPS Antibody - BSA Free

Western Blot: DHPS Antibody - BSA Free [NBP1-82648] -

Spermidine supplementation restored hepatic Eif5aH and mitochondrial protein levels in a dietary mouse model of NASH.a–c Western blot and densitometric analysis of hepatic Dhps, Dohh, Eif5aH, and Eif5a in NCD vs. WDF (a), and WDF vs. WDF + Spd (b) mice. The blots in a and b were processed in parallel. Densitometric analysis (c) was first normalized with GAPDH, and then calculated the fold change against WDF (NCD vs WDF, and WDF + Spd vs WDF). (n = 6) (d–f) Western blot and densitometric analysis of Tfam, PGC1 alpha, and mitochondrial proteins in the liver from mice fed with NCD vs. WDF (d), or WDF vs. WDF + Spd (e). The blots in d and e were processed in parallel. Densitometric analysis (f, n = 6) was first normalized with GAPDH, and then calculated the fold change against WDF (NCD vs WDF, and WDF + Spd vs WDF). (g, h) Mitochondrial DNA copy number (g) and circulating beta -hydroxybutyrate (h) in NCD (n = 6), WDF (n = 6), and WDF + Spd (n = 6) groups. Significance was calculated by one-way ANOVA or Kruskal–Wallis test, as appropriate. Source data are provided as a Source Data file. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36057633), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
DHPS Antibody - BSA Free

Western Blot: DHPS Antibody - BSA Free [NBP1-82648] -

Decreased DHPS-DOHH-EIF5AH pathway in NAFLD.a Polyamine synthesis and hypusination of EIF5A pathway in eukaryotic cells. Enzymes ARG1, ODC, SRM are involved in converting arginine to spermidine. DHPS and DOHH use spermidine to hypusinate EIF5A. b Violin plots showing mRNA levels of genes involved in endogenous polyamine biosynthesis and EIF5A hypusination in Control (n = 19), steatosis (n = 10), and NASH (n = 16) from publicly available database (accession number E-MEXP-3291, http://www.webcitation.org/5zyojNu7T)20. c Violin plots showing mRNA levels of genes involved in endogenous polyamine biosynthesis and EIF5A hypusination in Control (n = 12), steatosis (n = 9), and NASH (n = 17) from publicly available database (GSE48452)21. b, c Significance was calculated by one-way ANOVA or Kruskal–Wallis test, as appropriate. d Quantitative-PCR analysis of mRNA levels of polyamine metabolism genes in the livers from mice fed with NCD (n = 8) or WDF (n = 8) for 16 weeks. e Western blot and densitometric analysis of protein levels of Dhps, Dohh, eIF5AH, and eIF5A in the liver from mice fed with NCD (n = 7) or WDF (n = 6) for 16 weeks. f, g mRNA expression of genes in polyamine biosynthesis and hypusination pathways (f, n = 5), and protein levels of Dhps, Dohh, eIF5AH, and eIF5A (g, n = 3) in AML12 hepatic cells treated with fatty acids (FA, palmitic acid 0.6 mM, oleic acid 0.17 mM) for 48 h. f–g Data were shown as box-and-whisker with median (middle line), 25th–75th percentiles (box), and min-max values (whiskers). d–g significance was calculated by two-tailed Student’s t test or Mann–Whitney U test, as appropriate. Source data are provided as a Source Data file. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36057633), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
DHPS Antibody - BSA Free

Western Blot: DHPS Antibody - BSA Free [NBP1-82648] -

Decreased DHPS-DOHH-EIF5AH pathway in NAFLD.a Polyamine synthesis and hypusination of EIF5A pathway in eukaryotic cells. Enzymes ARG1, ODC, SRM are involved in converting arginine to spermidine. DHPS and DOHH use spermidine to hypusinate EIF5A. b Violin plots showing mRNA levels of genes involved in endogenous polyamine biosynthesis and EIF5A hypusination in Control (n = 19), steatosis (n = 10), and NASH (n = 16) from publicly available database (accession number E-MEXP-3291, http://www.webcitation.org/5zyojNu7T)20. c Violin plots showing mRNA levels of genes involved in endogenous polyamine biosynthesis and EIF5A hypusination in Control (n = 12), steatosis (n = 9), and NASH (n = 17) from publicly available database (GSE48452)21. b, c Significance was calculated by one-way ANOVA or Kruskal–Wallis test, as appropriate. d Quantitative-PCR analysis of mRNA levels of polyamine metabolism genes in the livers from mice fed with NCD (n = 8) or WDF (n = 8) for 16 weeks. e Western blot and densitometric analysis of protein levels of Dhps, Dohh, eIF5AH, and eIF5A in the liver from mice fed with NCD (n = 7) or WDF (n = 6) for 16 weeks. f, g mRNA expression of genes in polyamine biosynthesis and hypusination pathways (f, n = 5), and protein levels of Dhps, Dohh, eIF5AH, and eIF5A (g, n = 3) in AML12 hepatic cells treated with fatty acids (FA, palmitic acid 0.6 mM, oleic acid 0.17 mM) for 48 h. f–g Data were shown as box-and-whisker with median (middle line), 25th–75th percentiles (box), and min-max values (whiskers). d–g significance was calculated by two-tailed Student’s t test or Mann–Whitney U test, as appropriate. Source data are provided as a Source Data file. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36057633), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for DHPS Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DHPS

The unusual amino acid hypusine is formed posttranslationally and is only found in a single cellular protein, eukaryotic translation initiation factor 5A. In the first step of hypusine biosynthesis, deoxyhypusine synthase catalyzes the NAD-dependent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the EIF5A precursor protein to form the intermediate deoxyhypusine residue. This gene consists of nine exons spanning 6.6 kb. Three transcript variants have been isolated. However, only transcript variant 1 encodes an active protein. The shorter variants may act as modulating factors of DHPS activity.

Alternate Names

deoxyhypusine synthase, DHS, DS, EC 2.5.1, EC 2.5.1.46, hypusine, MIG13, migration-inducing gene 13

Gene Symbol

DHPS

Additional DHPS Products

Product Documents for DHPS Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DHPS Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for DHPS Antibody - BSA Free

Customer Reviews for DHPS Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DHPS Antibody - BSA Free and earn rewards!

Have you used DHPS Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...