DHPS Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-82648
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QVRGYDFNRGVNYRALLEAFGTTGFQATNFGRAVQQVNAMIEKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLIKC
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for DHPS Antibody - BSA Free
Western Blot: DHPS Antibody [NBP1-82648]
Western Blot: DHPS Antibody [NBP1-82648] - Analysis in control (vector only transfected HEK293T lysate) and DHPS over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).Immunocytochemistry/ Immunofluorescence: DHPS Antibody [NBP1-82648]
Immunocytochemistry/Immunofluorescence: DHPS Antibody [NBP1-82648] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol. Antibody staining is shown in green.Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648]
Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648]
Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648]
Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648] - Staining of human fallopian tube shows moderate cytoplasmic/membranous positivity in glandular cells.Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648]
Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648] - Staining of human pancreas shows weak cytoplasmic positivity in islets of Langerhans.Western Blot: DHPS Antibody - BSA Free [NBP1-82648] -
Spermidine supplementation restored hepatic Eif5aH and mitochondrial protein levels in a dietary mouse model of NASH.a–c Western blot and densitometric analysis of hepatic Dhps, Dohh, Eif5aH, and Eif5a in NCD vs. WDF (a), and WDF vs. WDF + Spd (b) mice. The blots in a and b were processed in parallel. Densitometric analysis (c) was first normalized with GAPDH, and then calculated the fold change against WDF (NCD vs WDF, and WDF + Spd vs WDF). (n = 6) (d–f) Western blot and densitometric analysis of Tfam, PGC1 alpha, and mitochondrial proteins in the liver from mice fed with NCD vs. WDF (d), or WDF vs. WDF + Spd (e). The blots in d and e were processed in parallel. Densitometric analysis (f, n = 6) was first normalized with GAPDH, and then calculated the fold change against WDF (NCD vs WDF, and WDF + Spd vs WDF). (g, h) Mitochondrial DNA copy number (g) and circulating beta -hydroxybutyrate (h) in NCD (n = 6), WDF (n = 6), and WDF + Spd (n = 6) groups. Significance was calculated by one-way ANOVA or Kruskal–Wallis test, as appropriate. Source data are provided as a Source Data file. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36057633), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: DHPS Antibody - BSA Free [NBP1-82648] -
Spermidine supplementation restored hepatic Eif5aH and mitochondrial protein levels in a dietary mouse model of NASH.a–c Western blot and densitometric analysis of hepatic Dhps, Dohh, Eif5aH, and Eif5a in NCD vs. WDF (a), and WDF vs. WDF + Spd (b) mice. The blots in a and b were processed in parallel. Densitometric analysis (c) was first normalized with GAPDH, and then calculated the fold change against WDF (NCD vs WDF, and WDF + Spd vs WDF). (n = 6) (d–f) Western blot and densitometric analysis of Tfam, PGC1 alpha, and mitochondrial proteins in the liver from mice fed with NCD vs. WDF (d), or WDF vs. WDF + Spd (e). The blots in d and e were processed in parallel. Densitometric analysis (f, n = 6) was first normalized with GAPDH, and then calculated the fold change against WDF (NCD vs WDF, and WDF + Spd vs WDF). (g, h) Mitochondrial DNA copy number (g) and circulating beta -hydroxybutyrate (h) in NCD (n = 6), WDF (n = 6), and WDF + Spd (n = 6) groups. Significance was calculated by one-way ANOVA or Kruskal–Wallis test, as appropriate. Source data are provided as a Source Data file. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36057633), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: DHPS Antibody - BSA Free [NBP1-82648] -
Decreased DHPS-DOHH-EIF5AH pathway in NAFLD.a Polyamine synthesis and hypusination of EIF5A pathway in eukaryotic cells. Enzymes ARG1, ODC, SRM are involved in converting arginine to spermidine. DHPS and DOHH use spermidine to hypusinate EIF5A. b Violin plots showing mRNA levels of genes involved in endogenous polyamine biosynthesis and EIF5A hypusination in Control (n = 19), steatosis (n = 10), and NASH (n = 16) from publicly available database (accession number E-MEXP-3291, http://www.webcitation.org/5zyojNu7T)20. c Violin plots showing mRNA levels of genes involved in endogenous polyamine biosynthesis and EIF5A hypusination in Control (n = 12), steatosis (n = 9), and NASH (n = 17) from publicly available database (GSE48452)21. b, c Significance was calculated by one-way ANOVA or Kruskal–Wallis test, as appropriate. d Quantitative-PCR analysis of mRNA levels of polyamine metabolism genes in the livers from mice fed with NCD (n = 8) or WDF (n = 8) for 16 weeks. e Western blot and densitometric analysis of protein levels of Dhps, Dohh, eIF5AH, and eIF5A in the liver from mice fed with NCD (n = 7) or WDF (n = 6) for 16 weeks. f, g mRNA expression of genes in polyamine biosynthesis and hypusination pathways (f, n = 5), and protein levels of Dhps, Dohh, eIF5AH, and eIF5A (g, n = 3) in AML12 hepatic cells treated with fatty acids (FA, palmitic acid 0.6 mM, oleic acid 0.17 mM) for 48 h. f–g Data were shown as box-and-whisker with median (middle line), 25th–75th percentiles (box), and min-max values (whiskers). d–g significance was calculated by two-tailed Student’s t test or Mann–Whitney U test, as appropriate. Source data are provided as a Source Data file. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36057633), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: DHPS Antibody - BSA Free [NBP1-82648] -
Decreased DHPS-DOHH-EIF5AH pathway in NAFLD.a Polyamine synthesis and hypusination of EIF5A pathway in eukaryotic cells. Enzymes ARG1, ODC, SRM are involved in converting arginine to spermidine. DHPS and DOHH use spermidine to hypusinate EIF5A. b Violin plots showing mRNA levels of genes involved in endogenous polyamine biosynthesis and EIF5A hypusination in Control (n = 19), steatosis (n = 10), and NASH (n = 16) from publicly available database (accession number E-MEXP-3291, http://www.webcitation.org/5zyojNu7T)20. c Violin plots showing mRNA levels of genes involved in endogenous polyamine biosynthesis and EIF5A hypusination in Control (n = 12), steatosis (n = 9), and NASH (n = 17) from publicly available database (GSE48452)21. b, c Significance was calculated by one-way ANOVA or Kruskal–Wallis test, as appropriate. d Quantitative-PCR analysis of mRNA levels of polyamine metabolism genes in the livers from mice fed with NCD (n = 8) or WDF (n = 8) for 16 weeks. e Western blot and densitometric analysis of protein levels of Dhps, Dohh, eIF5AH, and eIF5A in the liver from mice fed with NCD (n = 7) or WDF (n = 6) for 16 weeks. f, g mRNA expression of genes in polyamine biosynthesis and hypusination pathways (f, n = 5), and protein levels of Dhps, Dohh, eIF5AH, and eIF5A (g, n = 3) in AML12 hepatic cells treated with fatty acids (FA, palmitic acid 0.6 mM, oleic acid 0.17 mM) for 48 h. f–g Data were shown as box-and-whisker with median (middle line), 25th–75th percentiles (box), and min-max values (whiskers). d–g significance was calculated by two-tailed Student’s t test or Mann–Whitney U test, as appropriate. Source data are provided as a Source Data file. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36057633), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for DHPS Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: DHPS
Alternate Names
deoxyhypusine synthase, DHS, DS, EC 2.5.1, EC 2.5.1.46, hypusine, MIG13, migration-inducing gene 13
Gene Symbol
DHPS
Additional DHPS Products
Product Documents for DHPS Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for DHPS Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for DHPS Antibody - BSA Free
Customer Reviews for DHPS Antibody - BSA Free
There are currently no reviews for this product. Be the first to review DHPS Antibody - BSA Free and earn rewards!
Have you used DHPS Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...