DHRS9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89378

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DHRS9 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKA

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DHRS9 Antibody - BSA Free

DHRS9 Antibody - BSA Free Immunohistochemistry-Paraffin: DHRS9 Antibody - BSA Free [NBP1-89378]

Immunohistochemistry-Paraffin: DHRS9 Antibody - BSA Free [NBP1-89378]

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
DHRS9 Antibody - BSA Free Immunohistochemistry-Paraffin: DHRS9 Antibody - BSA Free [NBP1-89378]

Immunohistochemistry-Paraffin: DHRS9 Antibody - BSA Free [NBP1-89378]

Staining of human stomach shows moderate cytoplasmic/membranous positivity in glandular cells.
DHRS9 Antibody - BSA Free Immunohistochemistry-Paraffin: DHRS9 Antibody - BSA Free [NBP1-89378]

Immunohistochemistry-Paraffin: DHRS9 Antibody - BSA Free [NBP1-89378]

Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
DHRS9 Antibody - BSA Free Immunohistochemistry-Paraffin: DHRS9 Antibody - BSA Free [NBP1-89378]

Immunohistochemistry-Paraffin: DHRS9 Antibody - BSA Free [NBP1-89378]

Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Applications for DHRS9 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DHRS9

3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone. May play a role in the biosynthesis of retinoic acid from retinaldehyde, but seems to have low activity with retinoids. Can utilize both NADH and NADPH.

Alternate Names

dehydrogenase/reductase (SDR family) member 9,3alpha-HSD, EC 1.1, EC 1.1.1, EC 1.1.1.105, member 4,3-alpha-HSD, NADP-dependent retinol dehydrogenase/reductase, RDH15, RDH-E2, RDHL3ALPHA-HSD, RDHTBE

Gene Symbol

DHRS9

Additional DHRS9 Products

Product Documents for DHRS9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DHRS9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for DHRS9 Antibody - BSA Free

Customer Reviews for DHRS9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DHRS9 Antibody - BSA Free and earn rewards!

Have you used DHRS9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies