DHX36 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-24787

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DHX36 Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein DHX36 using the following amino acid sequence: VVEYLLEDVIEKIRYVPEQKEHRSQFKRGFMQGHVNRQEKEEKEAIYKERWPDYVRELRRRYSASTVDVIEMMEDDKVDLNLIVALIR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DHX36 Antibody - BSA Free

DHX36 Antibody Immunocytochemistry/Immunofluorescence: DHX36 Antibody [NBP3-24787]

Immunocytochemistry/Immunofluorescence: DHX36 Antibody [NBP3-24787]

Staining of human cell line EFO-21 shows localization to nucleoplasm & cytosol.

Applications for DHX36 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DHX36

DHX36, also known as Probable ATP-dependent RNA helicase DHX36, consists of three isoforms of sizes 114.7 kDa, 113.2 kDa, and 111.5 kDa and is involved in breaking down mRNA with the ARE element in their 3'-UTR strand. Current research links this protein to sex development and spermatogenesis. The protein interacts with RPS9, AGO1, UBC, AGO2, and PHB in the RNA degradation pathway.

Alternate Names

DDX36, DEAH (Asp-Glu-Ala-His) box polypeptide 36, DEAH box protein 36, EC 3.6.1, EC 3.6.4.13, G4 resolvase-1, KIAA1488G4R1, MLEL1RHAUDEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 36, MLE-like protein 1, probable ATP-dependent RNA helicase DHX36, RNA helicase associated with AU-rich element ARE

Gene Symbol

DHX36

Additional DHX36 Products

Product Documents for DHX36 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DHX36 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DHX36 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DHX36 Antibody - BSA Free and earn rewards!

Have you used DHX36 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies