DLX2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-54963

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DLX2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RRSKFKKMWKSGEIPSEQHPGASASPPCASPPVSAPASWDFGVPQRM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DLX2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: DLX2 Antibody [NBP2-54963]

Immunocytochemistry/ Immunofluorescence: DLX2 Antibody [NBP2-54963]

Immunocytochemistry/Immunofluorescence: DLX2 Antibody [NBP2-54963] - Staining of human cell line U-2 OS shows localization to nuclear speckles. Antibody staining is shown in green.

Applications for DLX2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DLX2

Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 2.

Alternate Names

distal-less homeo box 2, distal-less homeobox 2, homeobox protein DLX-2, TES1, TES-1

Gene Symbol

DLX2

Additional DLX2 Products

Product Documents for DLX2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DLX2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DLX2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DLX2 Antibody - BSA Free and earn rewards!

Have you used DLX2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies