DNAJC3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48704

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: YKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPSIAEYTVR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DNAJC3 Antibody - BSA Free

Western Blot: DNAJC3 Antibody [NBP2-48704]

Western Blot: DNAJC3 Antibody [NBP2-48704]

Western Blot: DNAJC3 Antibody [NBP2-48704] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: DNAJC3 Antibody [NBP2-48704]

Immunocytochemistry/ Immunofluorescence: DNAJC3 Antibody [NBP2-48704]

Immunocytochemistry/Immunofluorescence: DNAJC3 Antibody [NBP2-48704] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: DNAJC3 Antibody [NBP2-48704]

Immunohistochemistry-Paraffin: DNAJC3 Antibody [NBP2-48704]

Immunohistochemistry-Paraffin: DNAJC3 Antibody [NBP2-48704] - Staining of human thyroid gland shows cytoplasmic positivity in glandular cells.

Applications for DNAJC3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNAJC3

The 58-kDa inhibitor of the interferon-induced double-stranded RNA-activated protein kinase (PKR) is a cellular protein that is activated during influenza virus infection to down-regulate the activity of PKR. The 58-kDa inhibitor of the interferon-induced double-stranded RNA-activated protein kinase (PKR) is a cellular protein that is activated during influenza virus infection to down-regulate the activity of PKR (1). The P58 protein inhibits both the autophosphorylation of PKR and the phosphorylation of the PKR natural substrate, the alpha subunit of eukaryotic initiation factor eIF-2. Sequence analysis revealed that P58 is a member of the tetratricopeptide family of proteins (2). Also, like other J-domain proteins, P58 stimulated the ATPase activity of Hsc70. Taken together, data suggests that P58 is a co-chaperone, possibly directing hsp/Hsc70 to refold, and thus inhibit kinase function (3).

Alternate Names

DnaJ (Hsp40) homolog, subfamily C, member 3, HP58, Interferon-induced, double-stranded RNA-activated protein kinase inhibitor, P58FLJ21288, P58IPKProtein kinase inhibitor p58, PRKRIdnaJ homolog subfamily C member 3, Protein kinase inhibitor of 58 kDa, protein-kinase, interferon-inducible double stranded RNA dependent inhibitor

Gene Symbol

DNAJC3

Additional DNAJC3 Products

Product Documents for DNAJC3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DNAJC3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNAJC3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNAJC3 Antibody - BSA Free and earn rewards!

Have you used DNAJC3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...