DOCK10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58637

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LDSLDNSVTCECTPEETDSSENNLHADFAKYLTETEDTVKTTRNMERLNLFSLDPDIDTLKLQKKDLLEPESVIKPFEEKAAKRIMIICKALNSN

Reactivity Notes

Mouse 85%.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DOCK10 Antibody - BSA Free

Immunohistochemistry-Paraffin: DOCK10 Antibody [NBP2-58637]

Immunohistochemistry-Paraffin: DOCK10 Antibody [NBP2-58637]

Immunohistochemistry-Paraffin: DOCK10 Antibody [NBP2-58637] - Analysis in human lymph node and pancreas tissues using NBP2-58637 antibody. Corresponding DOCK10 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: DOCK10 Antibody [NBP2-58637]

Immunocytochemistry/ Immunofluorescence: DOCK10 Antibody [NBP2-58637]

Immunocytochemistry/Immunofluorescence: DOCK10 Antibody [NBP2-58637] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DOCK10 Antibody [NBP2-58637]

Immunohistochemistry-Paraffin: DOCK10 Antibody [NBP2-58637]

Immunohistochemistry-Paraffin: DOCK10 Antibody [NBP2-58637] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: DOCK10 Antibody [NBP2-58637]

Immunohistochemistry-Paraffin: DOCK10 Antibody [NBP2-58637]

Immunohistochemistry-Paraffin: DOCK10 Antibody [NBP2-58637] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: DOCK10 Antibody [NBP2-58637]

Immunohistochemistry-Paraffin: DOCK10 Antibody [NBP2-58637]

Immunohistochemistry-Paraffin: DOCK10 Antibody [NBP2-58637] - Staining of human cerrebral cortex shows moderate cytoplasmic positivity in glial cells.
Immunohistochemistry-Paraffin: DOCK10 Antibody [NBP2-58637]

Immunohistochemistry-Paraffin: DOCK10 Antibody [NBP2-58637]

Immunohistochemistry-Paraffin: DOCK10 Antibody [NBP2-58637] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for DOCK10 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC Retrieval method: HIER pH6.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DOCK10

DOCK10 is a potential Rho-guanine nucleotide exchange factor (Rho-GEF) that may function to activate small GTPases such as Rac and Cdc42. It is a member of the CZH (CDM-zizimin homology) family of proteins that contain two highly conserved domains, CZH1 and CZH2.

Alternate Names

dedicator of cytokinesis 10, dedicator of cytokinesis protein 10, DKFZp781A1532, DRIP2, KIAA0694protein zizimin 3, Nbla10300, ZIZ3dopamine receptor interacting protein 2, zizimin3, zizimin-3

Gene Symbol

DOCK10

Additional DOCK10 Products

Product Documents for DOCK10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DOCK10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DOCK10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DOCK10 Antibody - BSA Free and earn rewards!

Have you used DOCK10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...