DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) - Azide and BSA Free
Novus Biologicals | Catalog # NBP2-34604
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG1 Kappa/IgG1 Kappa Clone # DG1/447 + DOG-1.1
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
Recombinant human canine-1 protein (DG1/447) + A synthetic peptide from human canine-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1). (Uniprot: Q5XX6)
Localization
Cell Surface and Cytoplasmic
Marker
Marker for Gastrointestinal Stromal Tumors
Clonality
Monoclonal
Host
Mouse
Isotype
IgG1 Kappa/IgG1 Kappa
Theoretical MW
114 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
1.0 mg/ml of antibody purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS WITHOUT BSA & azide. Also available at 200 ug/ml WITH BSA & azide (NBP2-34285).
Antibody with azide - store at 2 to 8C. Antibody without azide - store at -20 to -80C.
Antibody with azide - store at 2 to 8C. Antibody without azide - store at -20 to -80C.
Scientific Data Images for DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) - Azide and BSA Free
Immunohistochemistry-Paraffin: DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) - Azide and BSA Free [NBP2-34604]
Immunohistochemistry-Paraffin: DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) - Azide and BSA Free [NBP2-34604] - Formalin-fixed, paraffin-embedded human GIST stained with DOG1 Monoclonal Antibody (DG1/447+ DOG1.1)Applications for DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) - Azide and BSA Free
Application
Recommended Usage
Immunohistochemistry
Optimal dilutions of this antibody should be experimentally determined.
Immunohistochemistry-Paraffin
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Immunohistochemistry (Formalin-fixed): 1-2ug/ml for 30 minutes at RT. Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 45 min at 95C followed by cooling at RT for 20 minutes.
Optimal dilution for a specific application should be determined.
Optimal dilution for a specific application should be determined.
Formulation, Preparation, and Storage
Purification
Protein A or G purified
Formulation
10 mM PBS
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
1.0 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20 to -80C. Avoid freeze-thaw cycles.
Background: ANO1/TMEM16A
Long Name
Anoctamin 1
Alternate Names
DOG1, ORAOV2, TAOS2, TMEM16A
Gene Symbol
ANO1
Additional ANO1/TMEM16A Products
Product Documents for DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) - Azide and BSA Free and earn rewards!
Have you used DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...