DUSP7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10614

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DUSP7 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat DUSP7 (XP_238551). Peptide sequence ATAEWQPEPGAPASVLGLLLQKLRDDGCQAYYLQGGFNKFQTEYSEHCET

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for DUSP7 Antibody - BSA Free

Western Blot: DUSP7 Antibody [NBP3-10614]

Western Blot: DUSP7 Antibody [NBP3-10614]

Western Blot: DUSP7 Antibody [NBP3-10614] - Western blot analysis of DUSP7 in Rat Pancreas lysates. Antibody dilution at 1.0ug/ml

Applications for DUSP7 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DUSP7

Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-basedprotein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosineand serine/threonine residues. DUSP7 belongs to a class of DUSPs, designated MKPs, that dephosphorylate MAPK(mitogen-activated protein kinase) proteins ERK (see MIM 601795), JNK (see MIM 601158), and p38 (see MIM 600289) withspecificity distinct from that of individual MKP proteins. MKPs contain a highly conserved C-terminal catalytic domainand an N-terminal Cdc25 (see MIM 116947)-like (CH2) domain. MAPK activation cascades mediate various physiologicprocesses, including cellular proliferation, apoptosis, differentiation, and stress responses (summary by Patterson etal., 2009 (PubMed 19228121)).(supplied by OMIM)

Alternate Names

DKFZp586F2224, dual specificity phosphatase 7, Dual specificity protein phosphatase PYST2, dual-specificity phosphatase-7, EC 3.1.3.16, EC 3.1.3.48, MKPX, MKP-X, PYST2dual specificity protein phosphatase 7

Gene Symbol

DUSP7

Additional DUSP7 Products

Product Documents for DUSP7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DUSP7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DUSP7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DUSP7 Antibody - BSA Free and earn rewards!

Have you used DUSP7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies