DYM Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13942

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DYM Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: MTRTRDKYLHTNCLAALANMSAQFRSLHQYAAQRIISLFSLLSKKHNKVLEQATQSLRGSLSSNDVPLPDYAQDLNVIEEVIR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DYM Antibody - BSA Free

Immunohistochemistry-Paraffin: DYM Antibody [NBP2-13942]

Immunohistochemistry-Paraffin: DYM Antibody [NBP2-13942]

Immunohistochemistry-Paraffin: DYM Antibody [NBP2-13942] - Staining of human liver shows strong cytoplasmic granular positivity in hepatocytes.
Immunohistochemistry-Paraffin: DYM Antibody [NBP2-13942]

Immunohistochemistry-Paraffin: DYM Antibody [NBP2-13942]

Immunohistochemistry-Paraffin: DYM Antibody [NBP2-13942] - Staining of human fallopian tube shows strong cytoplasmic granular positivity in glandular cells.
Immunohistochemistry-Paraffin: DYM Antibody [NBP2-13942]

Immunohistochemistry-Paraffin: DYM Antibody [NBP2-13942]

Immunohistochemistry-Paraffin: DYM Antibody [NBP2-13942] - Staining of human kidney shows strong cytoplasmic granular positivity in cells in tubules.
Immunohistochemistry-Paraffin: DYM Antibody [NBP2-13942]

Immunohistochemistry-Paraffin: DYM Antibody [NBP2-13942]

Immunohistochemistry-Paraffin: DYM Antibody [NBP2-13942] - Staining of human pancreas shows strong cytoplasmic granular positivity in exocrine glandular cells.

Applications for DYM Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DYM

The DYM gene encodes for a protein that is critical for correct organization of Golgi apparatus and is involved in skeletal development and brain functioning. Isoform 1 of this protein is 669 amino acids long at nearly 76 kDA while isoform 2 is 479 amino acids long at approximately 54 kDA. DYM is known to interact with ACO2, C12orf4, SPAG9, GMPS, and TBC1D22B genes. Defects in the DYM gene are known to cause Dyggve-Melchior-Clausen syndrome as well as Smith-McCort Dysplasia. DYM has also been investigated for its role in various diseases such as thyroiditis, acromegaly, dwarfism, gangliosidosis, turner syndrome, atherosclerosis, microencephaly, intellectual disabilities, and sponastrime dysplasia.

Alternate Names

DMCSMCFLJ20071, Dyggve-Melchior-Clausen syndrome protein, dymeclin, FLJ90130

Gene Symbol

DYM

Additional DYM Products

Product Documents for DYM Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DYM Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DYM Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DYM Antibody - BSA Free and earn rewards!

Have you used DYM Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies