E2F-4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10895

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all E2F-4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human E2F-4 (NP_001941). Peptide sequence SSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCDLFDVPVLNL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for E2F-4 Antibody - BSA Free

Immunohistochemistry: E2F-4 Antibody [NBP3-10895]

Immunohistochemistry: E2F-4 Antibody [NBP3-10895]

Immunohistochemistry: E2F-4 Antibody [NBP3-10895] - Immunohistochemical analysis of human intestine.

Applications for E2F-4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: E2F-4

E2F4 is a member of the E2F family of transcription factors. It binds DNA at the E2 recognition site found in the promoter region of a number of genes involved in cell cycle regulation and DNA replication. E2F4 binds to pRb, p107, and p130. Via its interaction with p130, E2F4 plays an important role in maintaining G2 arrest during G2 phase checkpoint activation.

Long Name

E2F Transcription Factor 4

Alternate Names

E2F4

Gene Symbol

E2F4

Additional E2F-4 Products

Product Documents for E2F-4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for E2F-4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for E2F-4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review E2F-4 Antibody - BSA Free and earn rewards!

Have you used E2F-4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies