ECHS1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38054

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ECHS1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 28-290 of human ECHS1 (NP_004083.3).

Sequence:
ASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ECHS1 Antibody - BSA Free

ECHS1 Antibody

Immunocytochemistry/ Immunofluorescence: ECHS1 Antibody [NBP3-38054] -

Immunocytochemistry/ Immunofluorescence: ECHS1 Antibody [NBP3-38054] - Immunofluorescence analysis of NIH/3T3 cells using ECHS1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
ECHS1 Antibody

Immunocytochemistry/ Immunofluorescence: ECHS1 Antibody [NBP3-38054] -

Immunocytochemistry/ Immunofluorescence: ECHS1 Antibody [NBP3-38054] - Immunofluorescence analysis of MCF7 cells using ECHS1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
ECHS1 Antibody

Immunocytochemistry/ Immunofluorescence: ECHS1 Antibody [NBP3-38054] -

Immunocytochemistry/ Immunofluorescence: ECHS1 Antibody [NBP3-38054] - Immunofluorescence analysis of HeLa cells using ECHS1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
ECHS1 Antibody

Western Blot: ECHS1 Antibody [NBP3-38054] -

Western Blot: ECHS1 Antibody [NBP3-38054] - Western Blot analysis of various lysates using ECHS1 Rabbit pAb at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)at 1:10000 dilution.
Lysates / proteins: 25 ug per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection:ECL Basic Kit.
Exposuretime: 30s.

Applications for ECHS1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ECHS1

ECHS1 is encoded by this gene functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. The gene product is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix. Transcript variants utilizing alternative transcription initiation sites have been described in the literature. [provided by RefSeq]

Alternate Names

EC 4.2.1, enoyl CoA hydratase, short chain, 1, mitochondrial, enoyl Coenzyme A hydratase, short chain, 1, mitochondrial, Enoyl-CoA hydratase 1, enoyl-CoA hydratase, mitochondrial, SCEHEC 4.2.1.17, Short-chain enoyl-CoA hydratase

Gene Symbol

ECHS1

Additional ECHS1 Products

Product Documents for ECHS1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ECHS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ECHS1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ECHS1 Antibody - BSA Free and earn rewards!

Have you used ECHS1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies