EDC3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57115

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (93%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IDTYERRSGTRSRGIPNERPTRYRHDENILESEPIVYRRIIVPHNVSKEFCTDSGLVVPSISYELHKKLLSVAEKHGLTLERRLE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for EDC3 Antibody - BSA Free

Western Blot: EDC3 Antibody [NBP2-57115]

Western Blot: EDC3 Antibody [NBP2-57115]

Western Blot: EDC3 Antibody [NBP2-57115] - Analysis in human cell line HEK 293.
Immunocytochemistry/ Immunofluorescence: EDC3 Antibody [NBP2-57115]

Immunocytochemistry/ Immunofluorescence: EDC3 Antibody [NBP2-57115]

Immunocytochemistry/Immunofluorescence: EDC3 Antibody [NBP2-57115] - Staining of human cell line MCF7 shows localization to cytoplasmic bodies. antibody staining is shown in green.

Applications for EDC3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EDC3

EDC3, also known as Enhancer of mRNA-decapping protein 3, is a 508 amino acid that is 56 kDa, located in the cytoplasm and expressed in theca and granulosa cells in ovary, Sertoli cells in testis (at protein level), brain and mammary glands; may play a role in mRNA decapping in the process of mRNA degradation, and also in spermiogenesis and oogenesis. Disease research is currently being studied with relation to central nervous system origin vertigo, patellofemoral pain syndrome and hordeolum. Interactions with the EDC3 protein have been shown to involve YWHAG, YWHAB, ZFP36, SFN, DDX6, YWHAZ, DCP2, UPF1, DCP1B and KBTBD7 in n exonucleolytic nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay, gene expression, and mRNA metabolic process pathways.

Alternate Names

enhancer of mRNA decapping 3 homolog (S. cerevisiae), enhancer of mRNA-decapping protein 3, FLJ21128, FLJ31777, hYjeF_N2, hYjeF_N2-15q23, LSM16, LSM16 homolog, LSM16 homolog (EDC3, S. cerevisiae), YJDC, yjeF domain containing, YjeF domain-containing protein 1, YjeF N-terminal domain-containing protein 2, YjeF_N2, YJEFN2yjeF domain containing (E.coli)

Gene Symbol

EDC3

Additional EDC3 Products

Product Documents for EDC3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EDC3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EDC3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EDC3 Antibody - BSA Free and earn rewards!

Have you used EDC3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...