eEF1A1 Antibody - Azide and BSA Free
Novus Biologicals | Catalog # NBP2-92880
![Western Blot: eEF1A1 AntibodyAzide and BSA Free [NBP2-92880]](https://resources.rndsystems.com/images/products/eEF1A1-Antibody-Western-Blot-NBP2-92880-img0005.jpg "Western Blot: eEF1A1 AntibodyAzide and BSA Free [NBP2-92880]")
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 301-400 of human eEF1A1 (NP_001393.1). EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAA
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for eEF1A1 Antibody - Azide and BSA Free
Western Blot: eEF1A1 AntibodyAzide and BSA Free [NBP2-92880]
Western Blot: eEF1A1 Antibody [NBP2-92880] - Western blot analysis of extracts of various cell lines, using eEF1A1 antibody (NBP2-92880) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.![Western Blot: eEF1A1 AntibodyAzide and BSA Free [NBP2-92880]](https://resources.rndsystems.com/images/products/eEF1A1 Antibody-Western Blot-NBP2-92880-img0006.jpg "Western Blot: eEF1A1 AntibodyAzide and BSA Free [NBP2-92880]")
Western Blot: eEF1A1 AntibodyAzide and BSA Free [NBP2-92880]
Western Blot: eEF1A1 Antibody [NBP2-92880] - Western blot analysis of extracts of various cell lines, using eEF1A1 antibody (NBP2-92880) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.![Immunohistochemistry-Paraffin: eEF1A1 Antibody - Azide and BSA Free [NBP2-92880]](https://resources.rndsystems.com/images/products/eEF1A1-Antibody-Immunohistochemistry-Paraffin-NBP2-92880-img0004.jpg "Immunohistochemistry-Paraffin: eEF1A1 Antibody - Azide and BSA Free [NBP2-92880]")
Immunohistochemistry-Paraffin: eEF1A1 Antibody - Azide and BSA Free [NBP2-92880]
Immunohistochemistry-Paraffin: eEF1A1 Antibody [NBP2-92880] - Immunohistochemistry of paraffin-embedded rat ovary using eEF1A1 Rabbit pAb (NBP2-92880) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.![Immunohistochemistry-Paraffin: eEF1A1 Antibody - Azide and BSA Free [NBP2-92880]](https://resources.rndsystems.com/images/products/eEF1A1-Antibody-Immunohistochemistry-Paraffin-NBP2-92880-img0002.jpg "Immunohistochemistry-Paraffin: eEF1A1 Antibody - Azide and BSA Free [NBP2-92880]")
Immunohistochemistry-Paraffin: eEF1A1 Antibody - Azide and BSA Free [NBP2-92880]
Immunohistochemistry-Paraffin: eEF1A1 Antibody [NBP2-92880] - Immunohistochemistry of paraffin-embedded mouse brain using eEF1A1 Rabbit pAb (NBP2-92880) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.![Immunohistochemistry-Paraffin: eEF1A1 Antibody - Azide and BSA Free [NBP2-92880]](https://resources.rndsystems.com/images/products/eEF1A1-Antibody-Immunohistochemistry-Paraffin-NBP2-92880-img0003.jpg "Immunohistochemistry-Paraffin: eEF1A1 Antibody - Azide and BSA Free [NBP2-92880]")
Immunohistochemistry-Paraffin: eEF1A1 Antibody - Azide and BSA Free [NBP2-92880]
Immunohistochemistry-Paraffin: eEF1A1 Antibody [NBP2-92880] - Immunohistochemistry of paraffin-embedded mouse kidney using eEF1A1 Rabbit pAb (NBP2-92880) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunocytochemistry/ Immunofluorescence: eEF1A1 Antibody - Azide and BSA Free [NBP2-92880] -
Immunocytochemistry/ Immunofluorescence: eEF1A1 Antibody - Azide and BSA Free [NBP2-92880] - Immunofluorescence analysis of C6 cells using eEF1A1 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: eEF1A1 Antibody - Azide and BSA Free [NBP2-92880] -
Immunocytochemistry/ Immunofluorescence: eEF1A1 Antibody - Azide and BSA Free [NBP2-92880] - Immunofluorescence analysis of Raw264.7 cells using eEF1A1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: eEF1A1 Antibody - Azide and BSA Free [NBP2-92880] -
Immunocytochemistry/ Immunofluorescence: eEF1A1 Antibody - Azide and BSA Free [NBP2-92880] - Immunofluorescence analysis of NIH/3T3 cells using eEF1A1 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: eEF1A1 Antibody - Azide and BSA Free [NBP2-92880] -
Immunocytochemistry/ Immunofluorescence: eEF1A1 Antibody - Azide and BSA Free [NBP2-92880] - Immunofluorescence analysis of HeLa cells using eEF1A1 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: eEF1A1 Antibody - Azide and BSA Free [NBP2-92880] -
Immunocytochemistry/ Immunofluorescence: eEF1A1 Antibody - Azide and BSA Free [NBP2-92880] - Immunofluorescence analysis of A-549 cells using eEF1A1 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: eEF1A1 Antibody - Azide and BSA Free [NBP2-92880] -
Immunocytochemistry/ Immunofluorescence: eEF1A1 Antibody - Azide and BSA Free [NBP2-92880] - Immunofluorescence analysis of U2OS cells using eEF1A1 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.Applications for eEF1A1 Antibody - Azide and BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50-1:200
Immunohistochemistry
1:50-1:200
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: eEF1A1
Alternate Names
CCS3, CCS-3, cervical cancer suppressor 3, CTCL tumor antigen, EE1A1, EEF-1, EEF1A, eEF1A-1, EF1AHNGC:16303, EF1a-like protein, EF-1-alpha-1, EF-Tu, elongation factor 1 alpha subunit, elongation factor 1-alpha 1, Elongation factor Tu, Eukaryotic elongation factor 1 A-1, eukaryotic translation elongation factor 1 alpha 1, eukaryotic translation elongation factor 1 alpha 1-like 14, FLJ25721, glucocorticoid receptor AF-1 specific elongation factor, GRAF-1EF, LENG7, leukocyte receptor cluster (LRC) member 7, Leukocyte receptor cluster member 7, MGC102687, MGC131894, MGC16224, prostate tumor-inducing protein 1, PTI1, translation elongation factor 1 alpha 1-like 14
Gene Symbol
EEF1A1
Additional eEF1A1 Products
Product Documents for eEF1A1 Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for eEF1A1 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.govCustomer Reviews for eEF1A1 Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review eEF1A1 Antibody - Azide and BSA Free and earn rewards!
Have you used eEF1A1 Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...