EEN Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38429

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat, Monkey

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all EEN Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 219-368 of human EEN (NP_003016.1).

Sequence:
VDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEVLVPLPQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for EEN Antibody - BSA Free

EEN Antibody

Western Blot: EEN Antibody [NBP3-38429] -

Western Blot: EEN Antibody [NBP3-38429] - Western blot analysis of lysates from COS-7 cells, using EEN Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.

Applications for EEN Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: EEN

Endophilin A2 is an SH3 domain containing protein implicated in endocytosis. It has been identified in human acute leukemia as a fusion partner of MLL (mixed-lineage leukemia). Because of its involvement in this chromosomal translocation, endophilin A2 is also known as EEN (extra eleven nineteen).

Alternate Names

CNSA1endophilin-2, EEN fusion partner of MLL, EENSH3 domain-containing GRB2-like protein 1, Endophilin-2, extra 11-19 leukemia fusion, Extra eleven-nineteen leukemia fusion gene protein, MGC111371, SH3 domain protein 2B, SH3-containing Grb-2-like 1 protein, SH3D2Bendophilin-A2, SH3-domain GRB2-like 1, SH3P8

Gene Symbol

SH3GL1

Additional EEN Products

Product Documents for EEN Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EEN Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EEN Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EEN Antibody - BSA Free and earn rewards!

Have you used EEN Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies