EFHD1 Antibody (1A8) - Azide and BSA Free

Novus Biologicals | Catalog # H00080303-M09

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1A8

Format

Azide and BSA Free
View all EFHD1 Primary Antibodies »

Product Specifications

Immunogen

EFHD1 (NP_079478.1, 168 a.a. ~ 238 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFN

Specificity

EFHD1 (1A8)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for EFHD1 Antibody (1A8) - Azide and BSA Free

Western Blot: EFHD1 Antibody (1A8) [H00080303-M09]

Western Blot: EFHD1 Antibody (1A8) [H00080303-M09]

Western Blot: EFHD1 Antibody (1A8) [H00080303-M09] - Analysis of EFHD1 expression in NIH/3T3 (Cat # L018V1).
Western Blot: EFHD1 Antibody (1A8) [H00080303-M09]

Western Blot: EFHD1 Antibody (1A8) [H00080303-M09]

Western Blot: EFHD1 Antibody (1A8) [H00080303-M09] - Analysis of EFHD1 expression in PC-12 (Cat # L012V1).
Western Blot: EFHD1 Antibody (1A8) [H00080303-M09]

Western Blot: EFHD1 Antibody (1A8) [H00080303-M09]

Western Blot: EFHD1 Antibody (1A8) [H00080303-M09] - Analysis of EFHD1 expression in Raw 264.7 (Cat # L024V1).
Western Blot: EFHD1 Antibody (1A8) [H00080303-M09]

Western Blot: EFHD1 Antibody (1A8) [H00080303-M09]

Western Blot: EFHD1 Antibody (1A8) [H00080303-M09] - Analysis of EFHD1 expression in K-562 (Cat # L009V1).

Applications for EFHD1 Antibody (1A8) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: EFHD1

EFHD1 is an EF-hand domain-containing protein that displays increased expression during neuronal differentiation (Tominaga and Tomooka, 2002 [PubMed 12270117]).[supplied by OMIM]

Alternate Names

DKFZp781H0842, EF-hand domain family, member D1, EF-hand domain-containing protein 1, EF-hand domain-containing protein D1, member D1, MST133, MSTP133, Swiprosin-2

Entrez Gene IDs

80303 (Human)

Gene Symbol

EFHD1

UniProt

NP_079478 (Human)

Additional EFHD1 Products

Product Documents for EFHD1 Antibody (1A8) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EFHD1 Antibody (1A8) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EFHD1 Antibody (1A8) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review EFHD1 Antibody (1A8) - Azide and BSA Free and earn rewards!

Have you used EFHD1 Antibody (1A8) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies