EI24 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13949

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (95%), Rat (96%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: GIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSRI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for EI24 Antibody - BSA Free

Western Blot: EI24 Antibody [NBP2-13949]

Western Blot: EI24 Antibody [NBP2-13949]

Western Blot: EI24 Antibody [NBP2-13949] - Analysis in human cell line HEL.
Immunocytochemistry/ Immunofluorescence: EI24 Antibody [NBP2-13949]

Immunocytochemistry/ Immunofluorescence: EI24 Antibody [NBP2-13949]

EI24-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13949-img0012.jpg
Immunohistochemistry-Paraffin: EI24 Antibody [NBP2-13949]

Immunohistochemistry-Paraffin: EI24 Antibody [NBP2-13949]

Immunohistochemistry-Paraffin: EI24 Antibody [NBP2-13949] - Staining of human liver shows strong cytoplasmic granular positivity in hepatocytes.
Immunohistochemistry-Paraffin: EI24 Antibody [NBP2-13949]

Immunohistochemistry-Paraffin: EI24 Antibody [NBP2-13949]

Immunohistochemistry-Paraffin: EI24 Antibody [NBP2-13949] - Staining of human parathyroid gland shows strong cytoplasmic granular positivity in glandular cells.
Immunohistochemistry-Paraffin: EI24 Antibody [NBP2-13949]

Immunohistochemistry-Paraffin: EI24 Antibody [NBP2-13949]

Immunohistochemistry-Paraffin: EI24 Antibody [NBP2-13949] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: EI24 Antibody [NBP2-13949]

Immunohistochemistry-Paraffin: EI24 Antibody [NBP2-13949]

Immunohistochemistry-Paraffin: EI24 Antibody [NBP2-13949] - Staining of human pancreas shows strong cytoplasmic granular positivity in exocrine glandular cells.
EI24 Antibody

Immunohistochemistry-Paraffin: EI24 Antibody [NBP2-13949] -

Immunohistochemistry-Paraffin: EI24 Antibody [NBP2-13949] -Staining of human stomach shows strong cytoplasmic granular positivity in glandular cells.
EI24 Antibody

Western Blot: EI24 Antibody [NBP2-13949] -

Western Blot: EI24 Antibody [NBP2-13949] - Loss of EI24 expression using CRISPR-Cas9 in MIA PaCa-2 cells decreased cell proliferation. MIA PaCa-2 cells were transfected with CRISPR-Cas9 control (gRNA) & EI24 gRNA (gEI24) using a lentiviral system. (A) After 48 h of incubation, EI24 protein expression was observed by immunofluorescence staining using an anti-EI24 antibody. (B) After 48 h of incubation, the EI24 protein level was observed by western blotting using an anti-EI24 antibody. Conversion of LC3-I to LC3-II & p62 accumulation were analyzed by western blotting using anti-LC3 & anti-p62 antibodies, respectively. Graphs represent the mean ± SEM of EI24, LC3-II, & p62 densitometry value to that of beta -actin (with gRNA values set to 1) from three independent experiments. Comparison were made using Student's t-test, *P < 0.05; **P < 0.01; ***P < 0.001. (C) After 24 h of incubation, cells were seeded into a 96-well plate (1,000 cells/well). Images acquired by the IncuCyte instrument at the indicated times were analyzed using the ZOOM 2016 program. Confluency was measured in triplicate wells for each sample. Values represent the means ± SEM (Student's t-test, *P < 0.05; **P < 0.01; ***P < 0.001). (D) Control & EI24 gRNA-transfected cells (5 × 106) were injected into both flanks of Balb/c nude mice. Tumor volume was measured on the indicated days. The y-axes of these graphs represent the fold change in tumor size relative to the initial tumor size. Values represent means ± SEM. (Student's t-test, n.s., not significant, control gRNA mice, n = 5; EI24 gRNA mice, n = 4). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31396480), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
EI24 Antibody

Western Blot: EI24 Antibody [NBP2-13949] -

Western Blot: EI24 Antibody [NBP2-13949] - Loss of EI24 expression in HCT116 cells impairs autophagy but not cell proliferation. HCT116 cells were transfected with 10 nM control siRNA (siCtrl) or siRNA targeting EI24 or ATG5. (A) The mRNA levels of EI24, ATG5, & GAPDH were analyzed by reverse-transcription PCR. (B) The protein levels of EI24 ATG5 & beta -actin were analyzed by western blotting. Representative data are shown. Values represent the ratio of the EI24 or ATG5 densitometry value to that of beta -actin (with siCtrl values set to 1). Conversion of LC3-I to LC3-II & p62 accumulation were analyzed by western blotting using anti-LC3 & anti-p62 antibodies, respectively. Graphs represent mean ± SEM of the LC3-II & p62 densitometry value to that of beta -actin (with siCtrl values set to 1) from three independent experiments. Comparison were made using Student's t-test, *P < 0.05; **P < 0.01. (C) After 24 h of transfection, cells were seeded into a 6-well plate & incubated for another 7 days. Cells were fixed & stained with crystal violet. (D) After 24 h of transfection, cells were seeded into a 96-well plate. Images acquired from the IncuCyte instrument at the indicated times were analyzed using the ZOOM 2016 program. Cell confluency was measured in triplicate wells for each sample. The plotted values represent means ± SEM. (E) Protein extracts from siRNA-transfected cells were analyzed for DNA fragmentation. The y-axes of the graphs indicate the extent of DNA fragmentation. Values plotted in the graphs represent means ± SEM (Student's t-test, n.s., not significant). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31396480), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
EI24 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: EI24 Antibody - BSA Free [NBP2-13949] -

Loss of EI24 expression using CRISPR-Cas9 in MIA PaCa-2 cells decreased cell proliferation. MIA PaCa-2 cells were transfected with CRISPR-Cas9 control (gRNA) and EI24 gRNA (gEI24) using a lentiviral system. (A) After 48 h of incubation, EI24 protein expression was observed by immunofluorescence staining using an anti-EI24 antibody. (B) After 48 h of incubation, the EI24 protein level was observed by western blotting using an anti-EI24 antibody. Conversion of LC3-I to LC3-II and p62 accumulation were analyzed by western blotting using anti-LC3 and anti-p62 antibodies, respectively. Graphs represent the mean +/- SEM of EI24, LC3-II, and p62 densitometry value to that of beta -actin (with gRNA values set to 1) from three independent experiments. Comparison were made using Student's t-test, *P < 0.05; **P < 0.01; ***P < 0.001. (C) After 24 h of incubation, cells were seeded into a 96-well plate (1,000 cells/well). Images acquired by the IncuCyte instrument at the indicated times were analyzed using the ZOOM 2016 program. Confluency was measured in triplicate wells for each sample. Values represent the means +/- SEM (Student's t-test, *P < 0.05; **P < 0.01; ***P < 0.001). (D) Control and EI24 gRNA-transfected cells (5 × 106) were injected into both flanks of Balb/c nude mice. Tumor volume was measured on the indicated days. The y-axes of these graphs represent the fold change in tumor size relative to the initial tumor size. Values represent means +/- SEM. (Student's t-test, n.s., not significant, control gRNA mice, n = 5; EI24 gRNA mice, n = 4). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/31396480), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for EI24 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF was reported in scientific literature (PMID: 31396480).

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EI24

The EI24 gene has higher expression in p53-expressing cells than in control cells and is an immediate-early inductiontarget of p53-mediated apoptosis. The protein encoded by this gene contains six putative transmembrane domains and maysuppress cell growth by

Alternate Names

EPG4, etoposide induced 2.4 mRNA, p53-induced gene 8 protein, PIG8etoposide-induced protein 2.4 homolog, TP53I8, tumor protein p53 inducible protein 8

Gene Symbol

EI24

Additional EI24 Products

Product Documents for EI24 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EI24 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for EI24 Antibody - BSA Free

Customer Reviews for EI24 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EI24 Antibody - BSA Free and earn rewards!

Have you used EI24 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...