eIF2B epsilon Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56363

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all eIF2B epsilon Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEFPLQQMDSPLDSSRYCALLL

Reactivity Notes

Mouse 84%, Rat 89%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for eIF2B epsilon Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: eIF2B epsilon Antibody [NBP2-56363]

Immunocytochemistry/ Immunofluorescence: eIF2B epsilon Antibody [NBP2-56363]

Immunocytochemistry/Immunofluorescence: eIF2B epsilon Antibody [NBP2-56363] - Staining of human cell line RT4 shows localization to cytosol. Antibody staining is shown in green.

Applications for eIF2B epsilon Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: eIF2B epsilon

The eIF2B epsilon gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and the genes encoding other E

Alternate Names

CACH, CLE, EIF-2B, eIF-2B GDP-GTP exchange factor subunit epsilon, EIF2BE, EIF2Bepsilon, eukaryotic translation initiation factor 2B, subunit 5 (epsilon, 82kD), eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa, LVWM, translation initiation factor eIF-2B subunit epsilon

Gene Symbol

EIF2B5

Additional eIF2B epsilon Products

Product Documents for eIF2B epsilon Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for eIF2B epsilon Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for eIF2B epsilon Antibody - BSA Free

There are currently no reviews for this product. Be the first to review eIF2B epsilon Antibody - BSA Free and earn rewards!

Have you used eIF2B epsilon Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies