ELA2A Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-15533

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Immunohistochemistry, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all CELA2A Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 80-150 of human CELA2A (NP_254275.1). TYRVGLGRHNLYVAESGSLAVSVSKIVVHKDWNSNQISKGNDIALLKLANPVSLTDKIQLACLPPAGTILP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ELA2A Antibody - Azide and BSA Free

Western Blot: ELA2A AntibodyAzide and BSA Free [NBP3-15533]

Western Blot: ELA2A AntibodyAzide and BSA Free [NBP3-15533]

Western Blot: ELA2A Antibody [NBP3-15533] - Western blot analysis of extracts of Mouse lung, using ELA2A Rabbit pAb (NBP3-15533) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
ELA2A Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: ELA2A Antibody - Azide and BSA Free [NBP3-15533] -

Immunocytochemistry/ Immunofluorescence: ELA2A Antibody - Azide and BSA Free [NBP3-15533] - Immunofluorescence analysis of paraffin-embedded mouse pancreas using ELA2A Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for ELA2A Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CELA2A

Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have sixelastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Like most of thehuman elastases, elastase 2A is secreted from the pancreas as a zymogen. In other species, elastase 2A has been shownto preferentially cleave proteins after leucine, methionine, and phenylalanine residues. (provided by RefSeq)

Long Name

Chymotrypsin Like Elastase 2A

Alternate Names

ELA2A, Elastase 2A

Gene Symbol

CELA2A

Additional CELA2A Products

Product Documents for ELA2A Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ELA2A Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for ELA2A Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ELA2A Antibody - Azide and BSA Free and earn rewards!

Have you used ELA2A Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies