ELOVL4 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-03895

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all ELOVL4 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ELOVL4 (NP_073563.1). MGLLDSEPGSVLNVVSTALNDTVEFYRWTWSIADKRVENWPLMQSPWPTLSISTLYLLFVWLGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRELFMG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ELOVL4 Antibody - Azide and BSA Free

Western Blot: ELOVL4 AntibodyAzide and BSA Free [NBP3-03895]

Western Blot: ELOVL4 AntibodyAzide and BSA Free [NBP3-03895]

Western Blot: ELOVL4 Antibody [NBP3-03895] - Analysis of A-431, using ELOVL4 antibody at 1:400 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 180s.
ELOVL4 Antibody - Azide and BSA Free

Western Blot: ELOVL4 Antibody [NBP3-03895] -

Western Blot: ELOVL4 Antibody [NBP3-03895] -analysis of lysates from A-431 cells using ELOVL4 Rabbit pAb at 1:600 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time:30s.
ELOVL4 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: ELOVL4 Antibody - Azide and BSA Free [ELOVL4] -

Immunocytochemistry/ Immunofluorescence: ELOVL4 Antibody - Azide and BSA Free [ELOVL4] - Immunofluorescence analysis of A-431 cells using ELOVL4 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
ELOVL4 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: ELOVL4 Antibody - Azide and BSA Free [ELOVL4] -

Immunocytochemistry/ Immunofluorescence: ELOVL4 Antibody - Azide and BSA Free [ELOVL4] - Immunofluorescence analysis of NIH/3T3 cells using ELOVL4 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
ELOVL4 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: ELOVL4 Antibody - Azide and BSA Free [ELOVL4] -

Immunocytochemistry/ Immunofluorescence: ELOVL4 Antibody - Azide and BSA Free [ELOVL4] - Immunofluorescence analysis of C6 cells using ELOVL4 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
ELOVL4 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: ELOVL4 Antibody - Azide and BSA Free [ELOVL4] -

Immunocytochemistry/ Immunofluorescence: ELOVL4 Antibody - Azide and BSA Free [ELOVL4] - Immunofluorescence analysis of L929 cells using ELOVL4 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for ELOVL4 Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ELOVL4

Mutations in ELOVL4, a 38-39 kDa protein photoreceptor cell-specific protein involved in the elongation of very long chain fatty acids, are linked with Stargardt-like macular dystrophy (STGD3), autosomal dominant macular dystrophy, and other pattern dystrophy. The ELOVL4 gene is homologous to mammalian and yeast enzymes involved in the membrane-bound fatty acid chain elongation system. It has been suggested that alterations in the biosynthesis of fatty acids may be implicated in the pathogenesis of inherited macular degeneration.

Alternate Names

ADMD, cancer/testis antigen 118, CT118, EC 2.3.1.n8, elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 4, elongation of very long chain fatty acids protein 4, FLJ17667, FLJ92876,3-keto acyl-CoA synthase ELOVL4, Stargardt disease 3 (autosomal dominant), STGD2, STGD3

Gene Symbol

ELOVL4

Additional ELOVL4 Products

Product Documents for ELOVL4 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ELOVL4 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for ELOVL4 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ELOVL4 Antibody - Azide and BSA Free and earn rewards!

Have you used ELOVL4 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies