EML4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-39055

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all EML4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GGVMLIWSKTTVEPTPGKGPKGVYQISKQIKAHDGSVFTLCQMRNGMLLTGGGKDRKIILWDHDLNPEREIEVPDQYGTI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for EML4 Antibody - BSA Free

Western Blot: EML4 Antibody [NBP2-39055]

Western Blot: EML4 Antibody [NBP2-39055]

Western Blot: EML4 Antibody [NBP2-39055] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line HepG2
Immunohistochemistry-Paraffin: EML4 Antibody [NBP2-39055]

Immunohistochemistry-Paraffin: EML4 Antibody [NBP2-39055]

Immunohistochemistry-Paraffin: EML4 Antibody [NBP2-39055] - Staining of human gallbladder.
Immunohistochemistry-Paraffin: EML4 Antibody [NBP2-39055]

Immunohistochemistry-Paraffin: EML4 Antibody [NBP2-39055]

Immunohistochemistry-Paraffin: EML4 Antibody [NBP2-39055] - Staining of human appendix shows high expression.
Immunohistochemistry-Paraffin: EML4 Antibody [NBP2-39055]

Immunohistochemistry-Paraffin: EML4 Antibody [NBP2-39055]

Immunohistochemistry-Paraffin: EML4 Antibody [NBP2-39055] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: EML4 Antibody [NBP2-39055]

Immunohistochemistry-Paraffin: EML4 Antibody [NBP2-39055]

Immunohistochemistry-Paraffin: EML4 Antibody [NBP2-39055] - Staining in human appendix and cerebral cortex tissues using anti-EML4 antibody. Corresponding EML4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: EML4 Antibody [NBP2-39055]

Immunohistochemistry-Paraffin: EML4 Antibody [NBP2-39055]

Immunohistochemistry-Paraffin: EML4 Antibody [NBP2-39055] - Staining of human cerebral cortex, gallbladder, kidney and lymph node using Anti-EML4 antibody NBP2-39055 (A) shows similar protein distribution across tissues to independent antibody NBP2-38319 (B).
Immunohistochemistry-Paraffin: EML4 Antibody [NBP2-39055]

Immunohistochemistry-Paraffin: EML4 Antibody [NBP2-39055]

Immunohistochemistry-Paraffin: EML4 Antibody [NBP2-39055] - Staining of human kidney.
Immunohistochemistry-Paraffin: EML4 Antibody [NBP2-39055]

Immunohistochemistry-Paraffin: EML4 Antibody [NBP2-39055]

Immunohistochemistry-Paraffin: EML4 Antibody [NBP2-39055] - Staining of human lymph node.

Applications for EML4 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EML4

Echinoderm microtubule associated protein like 4 (EML4) has been identified as part of a gene fusion with the kinase domain of the anaplastic lymphoma receptor tyrosine kinase (ALK) in non-small cell lung cancer. EML4 associates with in vitro polymerized microtubules. In the cell, phosphorylated EML4 associates with the mitotic spindle and is essential for proliferation and microtubule network formation. Alternative names for EML4 include EMAPL4, ropp120, C2orf2, ELP120, and EMAP-4.

Alternate Names

C2orf2, echinoderm microtubule associated protein like 4, echinoderm microtubule-associated protein-like 4, ELP120, EMAP-4, EMAPL4, FLJ10942, FLJ32318, Restrictedly overexpressed proliferation-associated protein, Ropp 120, ROPP120DKFZp686P18118

Gene Symbol

EML4

UniProt

Q9HC35 (Human)

Additional EML4 Products

Product Documents for EML4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EML4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EML4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EML4 Antibody - BSA Free and earn rewards!

Have you used EML4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies