EMP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86847

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all EMP2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for EMP2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: EMP2 Antibody [NBP1-86847]

Immunocytochemistry/ Immunofluorescence: EMP2 Antibody [NBP1-86847]

Immunocytochemistry/Immunofluorescence: EMP2 Antibody [NBP1-86847] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847]

Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847]

Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847]

Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847]

Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human skin shows moderate to strong positivity in plasma membrane in keratinocytes.
Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847]

Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847]

Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human pancreas shows moderate to strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847]

Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847]

Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human lung shows moderate to strong cytoplasmic positivity in pneumocytes.
Western Blot: EMP2 Antibody [NBP1-86847]

Western Blot: EMP2 Antibody [NBP1-86847]

Western Blot: EMP2 Antibody [NBP1-86847] - Analysis of EMP2 in NIH/3T3 transfectant using anti-EMP2 antibody (1:500 dilution). Image from verified customer review.
EMP2 Antibody - BSA Free Western Blot: EMP2 Antibody - BSA Free [NBP1-86847]

Western Blot: EMP2 Antibody - BSA Free [NBP1-86847]

Analysis in control (vector only transfected HEK293T lysate) and EMP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
EMP2 Antibody - BSA Free Western Blot: EMP2 Antibody - BSA Free [NBP1-86847]

Western Blot: EMP2 Antibody - BSA Free [NBP1-86847]

Analysis in human cell line MCF-7.

Applications for EMP2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 5 using NBP1-86847 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EMP2

Epithelial membrane protein-2 (EMP2), a tetraspan protein known to associate with and modify surface expression of certain integrin isoforms, was identified as a prognostic biomarker in human endometrial cancer. EMP2 is expressed in the majority of ovarian tumors and may be a feasible drug target in vivo. EMP2 in several cell types plays a role in growth control, invasion, metastasis, and protein trafficking. It can associate with integrin alpha v beta 3 and FAK, and promote integrin-mediated FAK-Src activation.

Long Name

Epithelial Membrane Protein 2

Alternate Names

XMP

Gene Symbol

EMP2

Additional EMP2 Products

Product Documents for EMP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EMP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for EMP2 Antibody - BSA Free

Customer Reviews for EMP2 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used EMP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Name: Anonymous
    Application: Western Blot
    Sample Tested: NIH3T3 transfectant
    Species: Human
    Verified Customer | Posted 01/26/2015
    EMP2 antibody NBP1-86847
    EMP2 Antibody - BSA Free NBP1-86847

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies