Endophilin A1/SH3GL2 Antibody (2G6) - Azide and BSA Free

Novus Biologicals | Catalog # H00006456-M06

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2G6

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

SH3GL2 (NP_003017, 64 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMREL

Specificity

SH3GL2 - SH3-domain GRB2-like 2 (2G6)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Endophilin A1/SH3GL2 Antibody (2G6) - Azide and BSA Free

Western Blot: Endophilin A1/SH3GL2 Antibody (2G6) [H00006456-M06]

Western Blot: Endophilin A1/SH3GL2 Antibody (2G6) [H00006456-M06]

Western Blot: Endophilin A1/SH3GL2 Antibody (2G6) [H00006456-M06] - Analysis of SH3GL2 expression in PC-12 (Cat # L012V1).
Western Blot: Endophilin A1/SH3GL2 Antibody (2G6) [H00006456-M06]

Western Blot: Endophilin A1/SH3GL2 Antibody (2G6) [H00006456-M06]

Western Blot: Endophilin A1/SH3GL2 Antibody (2G6) [H00006456-M06] - Analysis of SH3GL2 expression in Hela S3 NE (Cat # L013V3).
ELISA: Endophilin A1/SH3GL2 Antibody (2G6) [H00006456-M06]

ELISA: Endophilin A1/SH3GL2 Antibody (2G6) [H00006456-M06]

ELISA: Endophilin A1/SH3GL2 Antibody (2G6) [H00006456-M06] - Detection limit for recombinant GST tagged SH3GL2 is approximately 3ng/ml as a capture antibody.

Applications for Endophilin A1/SH3GL2 Antibody (2G6) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Endophilin A1/SH3GL2

Implicated in synaptic vesicle endocytosis. May recruit other proteins to membranes with high curvature

Long Name

SH3-domain GRB2-like 2

Alternate Names

CNSA2, EEN-B1, Endophilin-1, SH3D2A, SH3GL2, SH3P4

Entrez Gene IDs

6456 (Human)

Gene Symbol

SH3GL2

Additional Endophilin A1/SH3GL2 Products

Product Documents for Endophilin A1/SH3GL2 Antibody (2G6) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Endophilin A1/SH3GL2 Antibody (2G6) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Endophilin A1/SH3GL2 Antibody (2G6) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Endophilin A1/SH3GL2 Antibody (2G6) - Azide and BSA Free and earn rewards!

Have you used Endophilin A1/SH3GL2 Antibody (2G6) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...