Enolase 1 Antibody (9E5R2)

Novus Biologicals | Catalog # NBP3-33187

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 9E5R2
View all Enolase 1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Enolase 1 (P06733).

Sequence:
MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGT

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Enolase 1 Antibody (9E5R2)

Enolase 1 Antibody (9E5R2)

Western Blot: Enolase 1 Antibody (9E5R2) [NBP3-33187] -

Western Blot: Enolase 1 Antibody (9E5R2) [NBP3-33187] - Western blot analysis of various lysates using Enolase 1 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3s.

Applications for Enolase 1 Antibody (9E5R2)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Enolase 1

Enolase 1 encodes one of three enolase isoenzymes found in mammals; it encodes alpha-enolase, a homodimeric soluble enzyme, and also encodes a shorter monomeric structural lens protein, tau-crystallin. The two proteins are made from the same message. The full length protein, the isoenzyme, is found in the cytoplasm. The shorter protein is produced from an alternative translation start, is localized to the nucleus, and has been found to bind to an element in the c-myc promoter. A pseudogene has been identified that is located on the other arm of the same chromosome.

Alternate Names

2-phospho-D-glycerate hydro-lyase, Alpha enolase, C-myc promoter-binding protein, c-myc promoter-binding protein-1, EC 4.2.1, EC 4.2.1.11, ENO1L1, Enolase 1, enolase 1, (alpha), MBP-1, MBPB1, MPB-1, MPB1c-myc promoter-binding protein 1, MYC promoter-binding protein 1, NNE, Non-neural enolase, Phosphopyruvate hydratase, Plasminogen-binding protein, PPHalpha enolase like 1, tau-crystallin

Gene Symbol

ENO1

Additional Enolase 1 Products

Product Documents for Enolase 1 Antibody (9E5R2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Enolase 1 Antibody (9E5R2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Enolase 1 Antibody (9E5R2)

There are currently no reviews for this product. Be the first to review Enolase 1 Antibody (9E5R2) and earn rewards!

Have you used Enolase 1 Antibody (9E5R2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies