EPHX2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35892

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 30-240 of human EPHX2 (NP_001970.2).

Sequence:
LALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for EPHX2 Antibody - BSA Free

EPHX2 Antibody

Immunocytochemistry/ Immunofluorescence: EPHX2 Antibody [NBP3-35892] -

Immunocytochemistry/ Immunofluorescence: EPHX2 Antibody [NBP3-35892] - Immunofluorescence analysis of PC-12 cells using EPHX2 Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
EPHX2 Antibody

Immunocytochemistry/ Immunofluorescence: EPHX2 Antibody [NBP3-35892] -

Immunocytochemistry/ Immunofluorescence: EPHX2 Antibody [NBP3-35892] - Immunofluorescence analysis of NIH/3T3 cells using EPHX2 Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
EPHX2 Antibody

Western Blot: EPHX2 Antibody [NBP3-35892] -

Western Blot: EPHX2 Antibody [NBP3-35892] - Western blot analysis of various lysates using EPHX2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 30s.
EPHX2 Antibody

Immunocytochemistry/ Immunofluorescence: EPHX2 Antibody [NBP3-35892] -

Immunocytochemistry/ Immunofluorescence: EPHX2 Antibody [NBP3-35892] - Immunofluorescence analysis of MCF7 cells using EPHX2 Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for EPHX2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Epoxide Hydrolase 2/EPHX2

EPHX2 encodes a member of the epoxide hydrolase family. The protein, found in both the cytosol and peroxisomes, binds to specific epoxides and converts them to the corresponding dihydrodiols. Mutations in this gene have been associated with familial hypercholesterolemia. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.

Alternate Names

Bifunctional Epoxide Hydrolase 2, CEH, EPHX2, Epoxide Hydratase 2, Epoxide Hydrolase 2, Cytosolic, SEH

Gene Symbol

EPHX2

Additional Epoxide Hydrolase 2/EPHX2 Products

Product Documents for EPHX2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EPHX2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for EPHX2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EPHX2 Antibody - BSA Free and earn rewards!

Have you used EPHX2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...