Erbin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56104

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (94%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SENLKHIVNHDDVFEESEELSSDEEMKMAEMRPPLIETSINQPKVVALSNNKKDDTKETDSLSDEVTHNSNQNNSNCSSPS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Erbin Antibody - BSA Free

Western Blot: Erbin Antibody [NBP2-56104]

Western Blot: Erbin Antibody [NBP2-56104]

Western Blot: Erbin Antibody [NBP2-56104] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: Erbin Antibody [NBP2-56104]

Immunocytochemistry/ Immunofluorescence: Erbin Antibody [NBP2-56104]

Immunocytochemistry/Immunofluorescence: Erbin Antibody [NBP2-56104] - Staining of human cell line U-251 MG shows localization to nuclear speckles, plasma membrane & cell junctions. Antibody staining is shown in green.
Erbin Antibody - BSA Free

Western Blot: Erbin Antibody - BSA Free [NBP2-56104] -

Erbin promotes TFEB nuclear translocation and transcription activity. A Erbinfl/fl and Erbinfl/fl/Lyz2−cre BMDMs were treated with MDP for 6 h, and western blotting was used to estimate the protein levels of total TFEB and pTFEB (S211). B THP-1 macrophages were transfected with vector control or HA-Erbin for 36 h prior to western blot assays. C BMDMs were treated with 10μg/ml MDP for 6 h and then incubated with TFEB antibody. The fluorescence intensity of treated cells was measured by confocal microscopy. Scale bar: 25 μm. D THP-1 macrophages were transfected with vector control or HA-Erbin for 36 h. Then, cells were treated with or without MDP (10 μg/ml) for 6 h. Cytosolic and nuclear extracts were prepared and subjected to western blot analyses. Lamin A and beta -actin were used as the internal control for nuclear and cytosolic fractions, respectively. E Experiments were performed similarly to those in D, except indicated siRNA was used. F THP-1 macrophages were transfected with siRNA control or si-Erbin for 36 h and treated with or without MDP (10 μg/ml) for 6 h before qPCR analyses. The data shown are representative of 3 independent experiments Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38105228), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Erbin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Erbin

The ERBB2IP gene encodes a LAP2 protein that exists in nine isoforms: Isoform 1: 1,412 amino acids long, 158 kDA; isoform 2: 1,371 amino acids long, 153 kDA; isoform 3: 1,360 amino acids long, 152 kDA; isoform 4: 1,346 amino acids, 151 kDA; isoform 5: 1,356 amino acids long, 152 kDA; isoform 6: 1,340 amino acids long, 150 kDA; isoform 7: 1,302 amino acids long, 146 kDA; isoform 8: 1,419 amino acids long, 159 kDA; isoform 9 is 1,367 amino acids long at 153 kDA. ERBB2IP functions as an adapter for the receptor ERBB2, and through binding of this receptor, it contributes to the stabilization of this unphosphorylated state. ERBB2IP participates in the NOD pathway, TGF-beta receptor signaling pathway, signal transduction, and with NLR proteins. It is known to interact with genes PKP4, SMAD3, ERBB2, ZFYVE9, and CTNNB1. ERBB2IP is associated with breast cancer, carcinoma, cervical cancer, crohn's disease, and epidermolysis bullosa.

Long Name

ErbB2-interacting Protein

Alternate Names

Densin-180-like protein, ERBB2IP

Gene Symbol

ERBIN

Additional Erbin Products

Product Documents for Erbin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Erbin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for Erbin Antibody - BSA Free

Customer Reviews for Erbin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Erbin Antibody - BSA Free and earn rewards!

Have you used Erbin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...