Erbin Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-56104
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Validated:
Human
Predicted:
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SENLKHIVNHDDVFEESEELSSDEEMKMAEMRPPLIETSINQPKVVALSNNKKDDTKETDSLSDEVTHNSNQNNSNCSSPS
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Erbin Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: Erbin Antibody [NBP2-56104]
Immunocytochemistry/Immunofluorescence: Erbin Antibody [NBP2-56104] - Staining of human cell line U-251 MG shows localization to nuclear speckles, plasma membrane & cell junctions. Antibody staining is shown in green.Western Blot: Erbin Antibody - BSA Free [NBP2-56104] -
Erbin promotes TFEB nuclear translocation and transcription activity. A Erbinfl/fl and Erbinfl/fl/Lyz2−cre BMDMs were treated with MDP for 6 h, and western blotting was used to estimate the protein levels of total TFEB and pTFEB (S211). B THP-1 macrophages were transfected with vector control or HA-Erbin for 36 h prior to western blot assays. C BMDMs were treated with 10μg/ml MDP for 6 h and then incubated with TFEB antibody. The fluorescence intensity of treated cells was measured by confocal microscopy. Scale bar: 25 μm. D THP-1 macrophages were transfected with vector control or HA-Erbin for 36 h. Then, cells were treated with or without MDP (10 μg/ml) for 6 h. Cytosolic and nuclear extracts were prepared and subjected to western blot analyses. Lamin A and beta -actin were used as the internal control for nuclear and cytosolic fractions, respectively. E Experiments were performed similarly to those in D, except indicated siRNA was used. F THP-1 macrophages were transfected with siRNA control or si-Erbin for 36 h and treated with or without MDP (10 μg/ml) for 6 h before qPCR analyses. The data shown are representative of 3 independent experiments Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38105228), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for Erbin Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Western Blot
0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Erbin
Long Name
ErbB2-interacting Protein
Alternate Names
Densin-180-like protein, ERBB2IP
Gene Symbol
ERBIN
Additional Erbin Products
Product Documents for Erbin Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Erbin Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for Erbin Antibody - BSA Free
Customer Reviews for Erbin Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Erbin Antibody - BSA Free and earn rewards!
Have you used Erbin Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...