ERK5/BMK1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10647

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ERK5/BMK1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ERK5/BMK1 (NP_620603). Peptide sequence FDMGVADGPQDGQADSASLSASLLADWLEGHGMNPADIESLQREIQMDSP

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

88 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ERK5/BMK1 Antibody - BSA Free

Immunohistochemistry-Paraffin: ERK5/BMK1 Antibody [NBP3-10647]

Immunohistochemistry-Paraffin: ERK5/BMK1 Antibody [NBP3-10647]

Immunohistochemistry-Paraffin: ERK5/BMK1 Antibody [NBP3-10647] - Immunohistochemical analysis of formalin-fixed paraffin-embedded human adult liver tissue.

Applications for ERK5/BMK1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ERK5/BMK1

The extracellular signal-regulated kinase 5 (ERK5), also known as MAPK7 or big mitogen-activated protein kinase 1 (BMK1), is a member of the MAP kinase subfamily (1). ERK5 differs considerably from other MAPKs; it contains an unusually long carboxyl-terminal tail which might contribute to the regulation of its activity and/or localization. In response to extracellular signals, ERK5 translocates to the nucleus, where it regulates gene expression by phosphorylating, and activating different transcription factors (2). ERK5 also differs from other MAPKs in possessing a potent transcriptional activation domain which mediates protein-protein interactions with the myocyte enhancer factor 2 (MEF2) transcription factors (3). ERK5 is specifically activated by MAPK kinase 5 (MAP2K5/MEK5) and plays an important role in mammary epithelial proliferation, endothelial cell survival and normal embryonic development (4-5).

Long Name

Extracellular Signal-regulated Kinase 5

Alternate Names

BMK1, MAPK7

Gene Symbol

MAPK7

Additional ERK5/BMK1 Products

Product Documents for ERK5/BMK1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ERK5/BMK1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers
Intracellular Kinases

Customer Reviews for ERK5/BMK1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ERK5/BMK1 Antibody - BSA Free and earn rewards!

Have you used ERK5/BMK1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies