ERR gamma/NR3B3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91873

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ERR gamma/NR3B3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ERR gamma/NR3B3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ERR gamma/NR3B3 Antibody [NBP1-91873]

Immunocytochemistry/ Immunofluorescence: ERR gamma/NR3B3 Antibody [NBP1-91873]

Immunocytochemistry/Immunofluorescence: ERR gamma/NR3B3 Antibody [NBP1-91873] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleus.
Immunohistochemistry-Paraffin: ERR gamma/NR3B3 Antibody [NBP1-91873]

Immunohistochemistry-Paraffin: ERR gamma/NR3B3 Antibody [NBP1-91873]

Immunohistochemistry-Paraffin: ERR gamma/NR3B3 Antibody [NBP1-91873] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Applications for ERR gamma/NR3B3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ERR gamma/NR3B3

Estrogen related receptor (ERR gamma), a NR3 Steroid Receptor is an orphan member of the nuclear hormone receptor superfamily. All the ERR family members (1,2, and 3) share an almost identical DNA binding domain, which has 68% amino acid identity with that of estrogen receptor. Studies involving the crystal structure of the LBD have shown a complex between ERR3 and SRC1. ERR gamma has been suggested to affect differentiation of the brain, heart, and kidney. ERR gamma binds as a monomer to an extended half site of the ERRE type (TCAAGGTCA). ERR gamma has been shown to interact with PGC1 alpha and has been implicated in the regulation of mitochondrial energy metabolism. In humans, ERR gamma pre mRNA undergoes extensive alternative splicing at the 5 prime end, yielding at least six mRNA splice variants and two protein isoforms that differ by 23 amino acids in the N terminus. ERR gamma has been shown to be overexpressed in breast tumors, and its expression is correlated with levels of ErbB4, a likely indicator of preferred clinical course. As a result, ERR gamma has been suggested to be a potential biomarker for favorable clinical course and, possibly, hormonal sensitivity, and as a candidate target for therapeutic development.

Long Name

Estrogen-related Receptor gamma

Alternate Names

ERR3, ESRRG, NR3B3

Gene Symbol

ESRRG

Additional ERR gamma/NR3B3 Products

Product Documents for ERR gamma/NR3B3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ERR gamma/NR3B3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ERR gamma/NR3B3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ERR gamma/NR3B3 Antibody - BSA Free and earn rewards!

Have you used ERR gamma/NR3B3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies