ETFB Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35630

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ETFB Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 80-230 of human ETFB (NP_001976.1).

Sequence:
AMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ETFB Antibody - BSA Free

ETFB Antibody

Immunocytochemistry/ Immunofluorescence: ETFB Antibody [NBP3-35630] -

Immunocytochemistry/ Immunofluorescence: ETFB Antibody [NBP3-35630] - Immunofluorescence analysis of C6 cells using ETFB Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
ETFB Antibody

Immunocytochemistry/ Immunofluorescence: ETFB Antibody [NBP3-35630] -

Immunocytochemistry/ Immunofluorescence: ETFB Antibody [NBP3-35630] - Immunofluorescence analysis of U-2 OS cells using ETFB Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
ETFB Antibody

Immunocytochemistry/ Immunofluorescence: ETFB Antibody [NBP3-35630] -

Immunocytochemistry/ Immunofluorescence: ETFB Antibody [NBP3-35630] - Immunofluorescence analysis of L929 cells using ETFB Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
ETFB Antibody

Western Blot: ETFB Antibody [NBP3-35630] -

Western Blot: ETFB Antibody [NBP3-35630] - Western blot analysis of various lysates using ETFB Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 5s.

Applications for ETFB Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ETFB

ETFB is a is an electron-transfer-flavoprotein, (beta polypeptide), and a subcomponent of Electron transfer flavoprotein (ETF). ETF exists in the mitochondrial matrix as a heterodimer of 30-kD alpha subunits (ETFA) and 28-kD beta subunits (ETFB) and contains 1 flavin adenine dinucleotide (FAD) and 1 adenosine 5-prime monophosphate (AMP) per heterodimer. This electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases and transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase).

Alternate Names

beta-ETF, electron transfer flavoprotein beta subunit, electron transfer flavoprotein beta-subunit, electron transfer flavoprotein subunit beta, electron transfer flavoprotein, beta polypeptide, electron-transfer-flavoprotein, beta polypeptide, electron-transferring-flavoprotein, beta polypeptide, MADD

Gene Symbol

ETFB

Additional ETFB Products

Product Documents for ETFB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ETFB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ETFB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ETFB Antibody - BSA Free and earn rewards!

Have you used ETFB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies