EXOC2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-37953

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human EXOC2 (NP_060773.3).

Sequence:
MSRSRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGRGTSTVSFKLLKPEKIGILDQSAVWVDEMNYYDMRTDRNKGIPPLSLRPANPLGIEIEKSKFSQKDLEMLFHGMSADFTSENFSAAWYLIENHSNTSFEQLKMAVTNLKRQANKKSEGSLAYVKGGLSTFFEAQDALS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

104 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for EXOC2 Antibody - BSA Free

EXOC2 Antibody

Immunoprecipitation: EXOC2 Antibody [NBP3-37953] -

Immunoprecipitation: EXOC2 Antibody [NBP3-37953] - Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug EXOC2 antibody. Western blot was performed from the immunoprecipitate using EXOC2 antibody at a dilution of 1:1000.
EXOC2 Antibody

Western Blot: EXOC2 Antibody [NBP3-37953] -

Western Blot: EXOC2 Antibody [NBP3-37953] - Western blot analysis of various lysates using EXOC2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
EXOC2 Antibody

Immunocytochemistry/ Immunofluorescence: EXOC2 Antibody [NBP3-37953] -

Immunocytochemistry/ Immunofluorescence: EXOC2 Antibody [NBP3-37953] - Immunofluorescence analysis of U2OS cells using EXOC2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for EXOC2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: EXOC2

The protein encoded by the EXOC2 gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and the functions of the exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. This interaction has been shown to mediate filopodia formation in fibroblasts. (provided by RefSeq)

Alternate Names

exocyst complex component 2, Exocyst complex component Sec5, FLJ11026, SEC5, SEC5L1, SEC5-like 1, SEC5-like 1 (S. cerevisiae), Sec5p

Gene Symbol

EXOC2

Additional EXOC2 Products

Product Documents for EXOC2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EXOC2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EXOC2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EXOC2 Antibody - BSA Free and earn rewards!

Have you used EXOC2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...