FASTKD2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57917

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FASTKD2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QQVWKIEDVFTLQVVMKCIGKDAPIALKRKLEMKALRELDRFSVLNSQHMFEVLAAMNHRSLILLDECSKVVLDNIHGCPLRIMINILQSCKDLQY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FASTKD2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: FASTKD2 Antibody [NBP2-57917]

Immunocytochemistry/ Immunofluorescence: FASTKD2 Antibody [NBP2-57917]

Immunocytochemistry/Immunofluorescence: FASTKD2 Antibody [NBP2-57917] - Staining of human cell line U-2 OS shows localization to mitochondria & cytokinetic bridge.

Applications for FASTKD2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FASTKD2

FASTKD2 codes for a protien with two isoforms, one that has a length of 710 amino acids and a mass of approximately 81 kDa, with a shorter isoform with a length of 648 amino acids and a weight of approximately 75 kDa, and both isoforms code for a protein that may play a role in mitochondrial apoptosis. Current studies have been done on diseases and disorders relating to this gene, including breast cancer. FASTKD2 has also been shown to have interactions with ICT1, MYC, PHLDA3, TRAF6, and TSC22D1.

Alternate Names

FAST kinase domains 2, KIAA0971FAST kinase domain-containing protein 2

Gene Symbol

FASTKD2

Additional FASTKD2 Products

Product Documents for FASTKD2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FASTKD2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FASTKD2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FASTKD2 Antibody - BSA Free and earn rewards!

Have you used FASTKD2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies