FBXO7 Antibody - Azide and BSA Free
Novus Biologicals | Catalog # H00025793-B01P
![Western Blot: FBXO7 Antibody [H00025793-B01P]](https://resources.rndsystems.com/images/products/FBXO7-Antibody-Western-Blot-H00025793-B01P-img0003.jpg "Western Blot: FBXO7 Antibody [H00025793-B01P]")
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Mouse IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
FBXO7 (AAH08361.1, 1 a.a. - 522 a.a.) full-length human protein. MRLRVRLLKRTWPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPLTGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTSIQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM
Clonality
Polyclonal
Host
Mouse
Isotype
IgG
Description
Novus Biologicals Mouse FBXO7 Antibody - Azide and BSA Free (H00025793-B01P) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-FBXO7 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for FBXO7 Antibody - Azide and BSA Free
Western Blot: FBXO7 Antibody [H00025793-B01P]
Western Blot: FBXO7 Antibody [H00025793-B01P] - Analysis of FBXO7 expression in human placenta.![Immunocytochemistry/ Immunofluorescence: FBXO7 Antibody [H00025793-B01P]](https://resources.rndsystems.com/images/products/FBXO7-Antibody-Immunocytochemistry-Immunofluorescence-H00025793-B01P-img0001.jpg "Immunocytochemistry/ Immunofluorescence: FBXO7 Antibody [H00025793-B01P]")
Immunocytochemistry/ Immunofluorescence: FBXO7 Antibody [H00025793-B01P]
Immunocytochemistry/Immunofluorescence: FBXO7 Antibody [H00025793-B01P] - Analysis of purified antibody to FBXO7 on HeLa cell. (antibody concentration 10 ug/ml)![Immunohistochemistry-Paraffin: FBXO7 Antibody [H00025793-B01P]](https://resources.rndsystems.com/images/products/FBXO7-Antibody-Immunohistochemistry-Paraffin-H00025793-B01P-img0002.jpg "Immunohistochemistry-Paraffin: FBXO7 Antibody [H00025793-B01P]")
Immunohistochemistry-Paraffin: FBXO7 Antibody [H00025793-B01P]
Immunohistochemistry-Paraffin: FBXO7 Antibody [H00025793-B01P] - Analysis of purified antibody to FBXO7 on formalin-fixed paraffin-embedded human testis. (antibody concentration 3 ug/ml)![Western Blot: FBXO7 Antibody [H00025793-B01P]](https://resources.rndsystems.com/images/products/FBXO7-Antibody-Western-Blot-H00025793-B01P-img0004.jpg "Western Blot: FBXO7 Antibody [H00025793-B01P]")
Western Blot: FBXO7 Antibody [H00025793-B01P]
Western Blot: FBXO7 Antibody [H00025793-B01P] - Analysis of FBXO7 expression in transfected 293T cell line by FBXO7 polyclonal antibody. Lane 1: FBXO7 transfected lysate(57.42 KDa). Lane 2: Non-transfected lysate.Applications for FBXO7 Antibody - Azide and BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
Optimal dilutions of this antibody should be experimentally determined.
Immunohistochemistry
Optimal dilutions of this antibody should be experimentally determined.
Immunohistochemistry-Paraffin
Optimal dilutions of this antibody should be experimentally determined.
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is useful for Western Blot, Functional, Immunofluorescence, Immunohistochemistry-Paraffin
Formulation, Preparation, and Storage
Purification
Protein G purified
Formulation
PBS (pH 7.4)
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: FBXO7
Long Name
F-box Only Protein 7
Alternate Names
FBX7, PARK15, PKPS
Gene Symbol
FBXO7
UniProt
Additional FBXO7 Products
Product Documents for FBXO7 Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for FBXO7 Antibody - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for FBXO7 Antibody - Azide and BSA Free
Powered by Bioz
Customer Reviews for FBXO7 Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review FBXO7 Antibody - Azide and BSA Free and earn rewards!
Have you used FBXO7 Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...