FBXO8 Antibody (1C11) - Azide and BSA Free

Novus Biologicals | Catalog # H00026269-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 1C11

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

FBXO8 (NP_036312, 1 a.a. ~ 77 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGQGLWRVVRNQQLQQEGYSEQGYLTREQSRRMAASNISNTNHRKQVQGGIDIYHLLKARKSKEQEGFINLEMLPPE

Reactivity Notes

Human. Other species not tested.

Specificity

FBXO8 - F-box protein 8

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for FBXO8 Antibody (1C11) - Azide and BSA Free

Sandwich ELISA: FBXO8 Antibody (1C11) [H00026269-M01] - Detection limit for recombinant GST tagged FBXO8 is approximately 0.1ng/ml as a capture antibody.

Applications for FBXO8 Antibody (1C11) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: FBXO8

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. It contains a C-terminal amino acid sequence that bears a significant similarity with a portion of yeast Sec7p, a critical regulator of vesicular protein transport. This human protein may interact with ADP-ribosylation factor(s)(ARFs) and exhibit ARF-GEF (guanine nucleotide exchange factor) activity.

Alternate Names

F-box only protein 8, F-box protein 8, F-box/SEC7 protein FBS, FBSFBX8F-box protein Fbx8

Entrez Gene IDs

26269 (Human)

Gene Symbol

FBXO8

OMIM

605649 (Human)

Additional FBXO8 Products

Product Documents for FBXO8 Antibody (1C11) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FBXO8 Antibody (1C11) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FBXO8 Antibody (1C11) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review FBXO8 Antibody (1C11) - Azide and BSA Free and earn rewards!

Have you used FBXO8 Antibody (1C11) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...