FCHO2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-32694

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (99%). Backed by our 100% Guarantee.

Applications

Validated:

Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FCHO2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KAAVKSKKATDTYKLYVEKYALAKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAIKEIHLQIG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FCHO2 Antibody - BSA Free

Western Blot: FCHO2 Antibody [NBP2-32694]

Western Blot: FCHO2 Antibody [NBP2-32694]

Western Blot: FCHO2 Antibody [NBP2-32694] - HAP1 cells probed with anti-FCHO2 antibody (upper panel) or anti-ARH (LDLRAP1) antibody (lower panel). Image from a verified customer review.
Western Blot: FCHO2 Antibody [NBP2-32694]

Western Blot: FCHO2 Antibody [NBP2-32694]

Western Blot: FCHO2 Antibody [NBP2-32694] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP2-32694]

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP2-32694]

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP2-32694] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP2-32694]

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP2-32694]

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP2-32694] - Staining of human lymph node shows weak to moderate cytoplasmic positivity in non - germinal center cells.
Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP2-32694]

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP2-32694]

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP2-32694] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP2-32694]

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP2-32694]

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP2-32694] - Staining of human colon.
Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP2-32694]

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP2-32694]

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP2-32694] - Staining of human testis.
Simple Western: FCHO2 Antibody [NBP2-32694]

Simple Western: FCHO2 Antibody [NBP2-32694]

Simple Western: FCHO2 Antibody [NBP2-32694] - Simple Western lane view shows a specific band for FCHO2 in 0.2 mg/ml of RT-4 (left), A431 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: FCHO2 Antibody [NBP2-32694]

Simple Western: FCHO2 Antibody [NBP2-32694]

Simple Western: FCHO2 Antibody [NBP2-32694] - Electropherogram image(s) of corresponding Simple Western lane view. FCHO2 antibody was used at 1:20 dilution on RT-4 and A431 lysate(s).
Knockout Validated: FCHO2 Antibody [NBP2-32694]

Western Blot: FCHO2 Antibody [NBP2-32694]

FCHO2-Antibody-Knockout-Validated-NBP2-32694-img0020.jpg
FCHO2 Antibody Immunohistochemistry-Paraffin: FCHO2 Antibody Antibody [NBP2-32694]

Immunohistochemistry-Paraffin: FCHO2 Antibody Antibody [NBP2-32694]

Staining of human endometrium, kidney, placenta and skeletal muscle using NBP2-32694 (A) shows similar protein distribution across tissues to independent antibody NBP1-90904 (B).

Applications for FCHO2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Simple Western

1:20

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, A431, separated by Size, antibody dilution of 1:20, apparent MW was 117 kDa.

Reviewed Applications

Read 1 review rated 5 using NBP2-32694 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FCHO2

Alternate Names

FCH domain only 2

Gene Symbol

FCHO2

Additional FCHO2 Products

Product Documents for FCHO2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FCHO2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for FCHO2 Antibody - BSA Free

Customer Reviews for FCHO2 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used FCHO2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Name: Anonymous
    Application: Western Blot
    Sample Tested: human haploid HAP1 cell whole cell lysates
    Species: Human
    Verified Customer | Posted 01/16/2015
    HAP1 cells HAP1 cells probed with Novus anti-FCHO2 antibody (upper panel) or anti-ARH (LDLRAP1) antibody (lower panel)
    FCHO2 Antibody - BSA Free NBP2-32694

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies