FKBP10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49242

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FKBP10 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GLPTGYLFVWHKDPPANLFEDMDLNKDGEVPPEEFSTFIKAQVSEGKGRLMPGQDPEKTIGDMFQNQDRNQDGKITV

Reactivity Notes

Mouse (87%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FKBP10 Antibody - BSA Free

Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242]

Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242]

Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242] - Analysis in human endometrium and skeletal muscle tissues using NBP2-49242 antibody. Corresponding FKBP10 RNA-seq data are presented for the same tissues.
Western Blot: FKBP10 Antibody [NBP2-49242]

Western Blot: FKBP10 Antibody [NBP2-49242]

Western Blot: FKBP10 Antibody [NBP2-49242] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242]

Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242]

Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242] - Staining of human placenta shows moderate to strong cytoplasmic positivity in fibroblasts.
Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242]

Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242]

Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242] - Staining of human endometrium shows strong cytoplasmic positivity in stromal cells.
Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242]

Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242]

Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242] - Staining of human uterine cervix shows strong cytoplasmic positivity in fibroblasts.
Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242]

Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242]

Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-49242] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for FKBP10 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FKBP10

The FKBP10 gene encodes for a 582 amino acid long, 64 kDA peptidyl-prolyl cis-trans isomerase FKBP10 protein that accelerates the folding of proteins during synthesis through localizing to the endoplasmic reticulum and functioning as a molecular chaperone. FKBP10 is known to interact with various genes such as SLX1A, SLX1B, ELN, SLC2A4, and H2AFX. It has been researched regarding its role in carcinoma, bruck syndrome, osteogenesis imperfecta, ovarian cancer, and benign tumors.

Alternate Names

65 kDa FK506-binding protein, 65 kDa FKBP, EC 5.2.1.8, FK506 binding protein 10 (65 kDa), FK506 binding protein 10, 65 kDa, FK506-binding protein 10, FKBP-10, FKBP6, FKBP-65, FKBP65PPIase FKBP10, FLJ20683, FLJ22041, FLJ23833, hFKBP65, Immunophilin FKBP65, OI6, peptidyl-prolyl cis-trans isomerase FKBP10, PPIASE, rotamase

Gene Symbol

FKBP10

Additional FKBP10 Products

Product Documents for FKBP10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FKBP10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FKBP10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FKBP10 Antibody - BSA Free and earn rewards!

Have you used FKBP10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies