Flavin containing monooxygenase 4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14020

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Flavin containing monooxygenase 4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: KGLCKIPPSQKLMMEATEKEQLIKRGVFKDTSKDKFDYIAYMDDIAACIGTKPSIPLLFLKDPRLAWEV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Flavin containing monooxygenase 4 Antibody - BSA Free

Immunohistochemistry-Paraffin: Flavin containing monooxygenase 4 Antibody [NBP2-14020]

Immunohistochemistry-Paraffin: Flavin containing monooxygenase 4 Antibody [NBP2-14020]

Immunohistochemistry-Paraffin: Flavin containing monooxygenase 4 Antibody [NBP2-14020] Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.

Applications for Flavin containing monooxygenase 4 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Flavin containing monooxygenase 4

FMO4, also known as Dimethylaniline monooxygenase [N-oxide-forming] 4 or Flavin containing monooxygenase 4, is a 558 amino acid protein that is 63 kDa, most commonly found in liver tissue with microsome membrane and endoplasmic reticulum membrane subcellular location, and is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. Current research is being performed on several diseases and disorders including trimethylaminuria, hepatitis, prader-willi syndrome, plasma cell neoplasm, and hearing loss. This protein has been shown to have interactions with CYP3A5, CYP3A4, CYP3A7, CYP2D6 and CYP3A43 in xenobiotic metabolic and oxidation-reduction pathways.

Alternate Names

dimethylaniline monooxygenase [N-oxide-forming] 4, Dimethylaniline oxidase 4, EC 1.14.13.8, flavin containing monooxygenase 4, FMO 4, FMO2, Hepatic flavin-containing monooxygenase 4

Gene Symbol

FMO4

Additional Flavin containing monooxygenase 4 Products

Product Documents for Flavin containing monooxygenase 4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Flavin containing monooxygenase 4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Flavin containing monooxygenase 4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Flavin containing monooxygenase 4 Antibody - BSA Free and earn rewards!

Have you used Flavin containing monooxygenase 4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies