FLNC Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89300

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human, Mouse

Predicted:

Mouse (99%), Rat (99%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FLNC Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: HSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FLNC Antibody - BSA Free

Immunohistochemistry-Paraffin: FLNC Antibody [NBP1-89300]

Immunohistochemistry-Paraffin: FLNC Antibody [NBP1-89300]

Immunohistochemistry-Paraffin: FLNC Antibody [NBP1-89300] - Analysis in human skeletal muscle and liver tissues. Corresponding FLNC RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: FLNC Antibody [NBP1-89300]

Immunocytochemistry/ Immunofluorescence: FLNC Antibody [NBP1-89300]

Immunocytochemistry/Immunofluorescence: FLNC Antibody [NBP1-89300] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol. Antibody staining shown in green.
Immunohistochemistry-Paraffin: FLNC Antibody [NBP1-89300]

Immunohistochemistry-Paraffin: FLNC Antibody [NBP1-89300]

Immunohistochemistry-Paraffin: FLNC Antibody [NBP1-89300] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: FLNC Antibody [NBP1-89300]

Immunohistochemistry-Paraffin: FLNC Antibody [NBP1-89300]

Immunohistochemistry-Paraffin: FLNC Antibody [NBP1-89300] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry-Frozen: FLNC Antibody [NBP1-89300]

Immunohistochemistry-Frozen: FLNC Antibody [NBP1-89300]

Immunohistochemistry-Frozen: FLNC Antibody [NBP1-89300] - Mouse muscle vasus transverse cryosection stained with Filamin C antibody (NBP1-89300). IHC-Fr image submitted by a verified customer review.
Immunohistochemistry-Paraffin: FLNC Antibody [NBP1-89300]

Immunohistochemistry-Paraffin: FLNC Antibody [NBP1-89300]

Immunohistochemistry-Paraffin: FLNC Antibody [NBP1-89300] - Staning of human tonsil shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: FLNC Antibody [NBP1-89300]

Immunohistochemistry-Paraffin: FLNC Antibody [NBP1-89300]

Immunohistochemistry-Paraffin: FLNC Antibody [NBP1-89300] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

Applications for FLNC Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25 - 2 ug/mL

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Frozen

Validated from a verified customer review.

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 4 using NBP1-89300 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FLNC

FLNC, Filamin-c, Filamin-2 (FLN2), Actin binding-like protein (APBL) (290.8 kDa) is an isoform of the Filamin proteins family. Filamins are broadly expressed and function as actin-binding and actin-crosslinking proteins. Structurally, Filamins consist of three main domains; N-terminal actin-binding domain, multiple central immunoglobulin (Ig) domains, and a C-terminal domain which supports homodimerization (1, 2). Functionally, Filamins play a role in cytoskeleton structure through interactions with actin, but they are implicated in a wide range of processes through their interactions with diverse molecular partners such as signaling molecules (MKK4, JNK1), ion channels (Kv4.2, Kir2.1), receptors (Insulin, Calcitonin), and transcription factors (Smad1-6, Foxc1) (3).

Three isoforms of Filamin are expressed in mammals, identified as FLNA, FLNB and FLNC. FLNC is considered a muscle specific Filamin isoform for its high expression in cardiac and skeletal muscles. In muscle tissue, FLNC localizes to the Z-line, sarcolemma, myotendinous and intercalated disks (2). FLNC interacts with various muscle proteins via a non-conserved sequence within its Ig domain 20. Some muscle binding partners for FLNC include gamma and delta-sarcoglycans in the sarcolemma, and FATZ, myozenins, myotilin and myopodin in the Z-discs (2, 4). FLNC variants are associated with various inherited pathological conditions including myofibrillar myopathy 5, distal myopathy 4, dilated cardiomyopathy, hypertrophic cardiomyopathy, and restrictive cardiomyopathy (2, 5).

References

1. Chiang, W., Greaser, M. L., & Lyons, G. E. (2000). Filamin isogene expression during mouse myogenesis. Developmental Dynamics. https://doi.org/10.1002/(sici)1097-0177(200001)217:199::aid-dvdy9>3.3.co;2-x

2. Leber, Y., Ruparelia, A. A., Kirfel, G., van der Ven, P. F. M., Hoffmann, B., Merkel, R.,... Furst, D. O. (2016). Filamin C is a highly dynamic protein associated with fast repair of myofibrillar microdamage. Human Molecular Genetics. https://doi.org/10.1093/hmg/ddw135

3. Nakamura, F., Stossel, T. P., & Hartwig, J. H. (2011). The filamins: Organizers of cell structure and function. Cell Adhesion and Migration. https://doi.org/10.4161/cam.5.2.14401

4. Thompson, T. G., Chan, Y. M., Hack, A. A., Brosius, M., Rajala, M., Lidov, H. G. W.,... Kunkel, L. M. (2000). Filamin 2 (FLN2): A muscle-specific sarcoglycan interacting protein. Journal of Cell Biology. https://doi.org/10.1083/jcb.148.1.115

5. Brodehl, A., Ferrier, R. A., Hamilton, S. J., Greenway, S. C., Brundler, M. A., Yu, W.,... Scherer, S. (2016). Mutations in FLNC are Associated with Familial Restrictive Cardiomyopathy. Human Mutation. https://doi.org/10.1002/humu.22942

Alternate Names

ABP-280, ABP280A, ABP-280-like protein, ABPA, ABP-L, ABPLABP-L, gamma filamin, Actin-binding-like protein, filamin 2, filamin C, gamma, filamin C, gamma (actin binding protein 280), Filamin-2, filamin-C, FLJ10186, FLN2actin binding protein 280, FLNc, FLN-C, Gamma-filamin

Gene Symbol

FLNC

Additional FLNC Products

Product Documents for FLNC Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FLNC Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for FLNC Antibody - BSA Free

Customer Reviews for FLNC Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used FLNC Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • FLNC Antibody
    Name: Pankaj Pathak
    Application: Immunohistochemistry-Frozen
    Sample Tested: Skeletal muscle tissue and Mouse skeletal muscle
    Species: Mouse
    Verified Customer | Posted 06/28/2021
    1. TA mouse muscle longitudinal section and (2.) Vasus transverse section stained with Filamin C antibody (NBP1-89300)
    Pathak, P., Blech-Hermoni, Y., Subedi, K. et al. Myopathy associated LDB3 mutation causes Z-disc disassembly and protein aggregation through PKC alpha and TSC2-mTOR downregulation. Commun Biol 4, 355 (2021). https://doi.org/10.1038/s42003-021-01864-1
    FLNC Antibody - BSA Free NBP1-89300
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies