FNBP1L Antibody (1E6) - Azide and BSA Free

Novus Biologicals | Catalog # H00054874-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1E6

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

FNBP1L (NP_060207.2, 175 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LNLRTHMADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERK

Specificity

This product is specific for Human FNBP1L monoclonal antibody (M01), clone 1E6 [Gene ID: 54874].

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for FNBP1L Antibody (1E6) - Azide and BSA Free

Western Blot: FNBP1L Antibody (1E6) [H00054874-M01]

Western Blot: FNBP1L Antibody (1E6) [H00054874-M01]

Western Blot: FNBP1L Antibody (1E6) [H00054874-M01] - FNBP1L monoclonal antibody (M01), clone 1E6. Analysis of FNBP1L expression in HepG2.
Sandwich ELISA: FNBP1L Antibody (1E6) [H00054874-M01] - Detection limit for recombinant GST tagged FNBP1L is 1 ng/ml as a capture antibody.

Applications for FNBP1L Antibody (1E6) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Mouse monoclonal antibody raised against a partial recombinant FNBP1L.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: FNBP1L

The protein encoded by the FNBP1L gene binds to both CDC42 and N-WASP. This protein promotes CDC42-induced actin polymerization by activating the N-WASP-WIP complex and, therefore, is involved in a pathway that links cell surface signals to the actin cytoskeleton. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Alternate Names

C1orf39, chromosome 1 open reading frame 39, FLJ20275, formin binding protein 1-like, formin-binding protein 1-like, toca-1, TOCA1Transducer of Cdc42-dependent actin assembly protein 1, transducer of Cdc42-dependent actin assembly 1

Gene Symbol

FNBP1L

Additional FNBP1L Products

Product Documents for FNBP1L Antibody (1E6) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FNBP1L Antibody (1E6) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FNBP1L Antibody (1E6) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review FNBP1L Antibody (1E6) - Azide and BSA Free and earn rewards!

Have you used FNBP1L Antibody (1E6) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...