FOXL2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49608

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FOXL2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MMASYPEPEDAAGALLAPETGRTVKEPEGPPPSPGKGG

Reactivity Notes

Mouse (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FOXL2 Antibody - BSA Free

Immunohistochemistry-Paraffin: FOXL2 Antibody [NBP2-49608]

Immunohistochemistry-Paraffin: FOXL2 Antibody [NBP2-49608]

Immunohistochemistry-Paraffin: FOXL2 Antibody [NBP2-49608] - Staining in human ovary and skeletal muscle tissues.. Corresponding FOXL2 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: FOXL2 Antibody [NBP2-49608]

Immunocytochemistry/ Immunofluorescence: FOXL2 Antibody [NBP2-49608]

Immunocytochemistry/Immunofluorescence: FOXL2 Antibody [NBP2-49608] - Immunofluorescent staining of human cell line SiHa shows localization to nucleus & cytokinetic bridge. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FOXL2 Antibody [NBP2-49608]

Immunohistochemistry-Paraffin: FOXL2 Antibody [NBP2-49608]

Immunohistochemistry-Paraffin: FOXL2 Antibody [NBP2-49608] - Staining of human fallopian tube shows moderate nuclear positivity in stromal cells.
Immunohistochemistry-Paraffin: FOXL2 Antibody [NBP2-49608]

Immunohistochemistry-Paraffin: FOXL2 Antibody [NBP2-49608]

Immunohistochemistry-Paraffin: FOXL2 Antibody [NBP2-49608] - Staining of human ovary shows moderate nuclear positivity in stromal cells.
Immunohistochemistry-Paraffin: FOXL2 Antibody [NBP2-49608]

Immunohistochemistry-Paraffin: FOXL2 Antibody [NBP2-49608]

Immunohistochemistry-Paraffin: FOXL2 Antibody [NBP2-49608] - Staining of human skeletal muscle shows no positivity in myocytes.
Immunohistochemistry-Paraffin: FOXL2 Antibody [NBP2-49608]

Immunohistochemistry-Paraffin: FOXL2 Antibody [NBP2-49608]

Immunohistochemistry-Paraffin: FOXL2 Antibody [NBP2-49608] - Staining of human endometrium shows weak nuclear positivity in cells in endometrial stroma.
FOXL2 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: FOXL2 Antibody - BSA Free [NBP2-49608]

Chromatin Immunoprecipitation-exo-Seq: FOXL2 Antibody - BSA Free [NBP2-49608]

ChIP-Exo-Seq composite graph for Anti-FOXL2 (NBP2-49608) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for FOXL2 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

0.1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FOXL2

There are 2 forms of the blepharophimosis/ptosis/epicanthus inversus syndrome. In one form, called type I, eyelid abnormalities are associated with ovarian failure. In the second type, called type II, only the eyelid defects are found. Both types map to 3q23. Crisponi et al. (2001) refined the physical mapping of the BPES critical region and positionally cloned a novel, putative winged helix/forkhead transcription factor gene, FOXL2, in which they found mutations to produce truncated proteins in type I families and larger proteins in type II. Consistent with an involvement in those tissues, FOXL2 was selectively expressed in the mesenchyme of developing mouse eyelids and in adult ovarian follicles; in adult humans, it appeared predominantly in the ovary.

Long Name

Forkhead Box L2

Alternate Names

BPES, BPES1, PFRK, PINTO, POF3

Gene Symbol

FOXL2

Additional FOXL2 Products

Product Documents for FOXL2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FOXL2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FOXL2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FOXL2 Antibody - BSA Free and earn rewards!

Have you used FOXL2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies