FPRL1/FPR2 Antibody (2G8) - Azide and BSA Free

Novus Biologicals | Catalog # H00002358-M03

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2G8

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

FPR2 (AAH29125.1, 163 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR

Specificity

FPRL1 - formyl peptide receptor-like 1 (2G8)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for FPRL1/FPR2 Antibody (2G8) - Azide and BSA Free

Western Blot: FPRL1/FPR2 Antibody (2G8) [H00002358-M03]

Western Blot: FPRL1/FPR2 Antibody (2G8) [H00002358-M03]

Western Blot: FPRL1/FPR2 Antibody (2G8) [H00002358-M03] - Analysis of FPR2 expression in HeLa.
ELISA: FPRL1/FPR2 Antibody (2G8) [H00002358-M03]

ELISA: FPRL1/FPR2 Antibody (2G8) [H00002358-M03]

ELISA: FPRL1/FPR2 Antibody (2G8) [H00002358-M03] - Detection limit for recombinant GST tagged FPR2 is 1 ng/ml as a capture antibody.

Applications for FPRL1/FPR2 Antibody (2G8) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: FPRL1/FPR2

Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors.Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein thatactivates a phosphatidylinositol-calcium second messenger system. The activation of LXA4R could result in ananti-inflammatory outcome counteracting the actions of proinflammatory signals such as LTB4 (leukotriene B4)

Long Name

Formyl Peptide Receptor-like 1

Alternate Names

ALXR, FMLP-R-I, FPR2, HM63, LXA4 Receptor, RFP

Entrez Gene IDs

2358 (Human)

Gene Symbol

FPR2

Additional FPRL1/FPR2 Products

Product Documents for FPRL1/FPR2 Antibody (2G8) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FPRL1/FPR2 Antibody (2G8) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FPRL1/FPR2 Antibody (2G8) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review FPRL1/FPR2 Antibody (2G8) - Azide and BSA Free and earn rewards!

Have you used FPRL1/FPR2 Antibody (2G8) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for FPRL1/FPR2 Antibody (2G8) - Azide and BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I am looking for an FPRL1 antibody that is reactive to mouse only. Does Novus have the antibody in question?

    A: To answer your question, unfortunately all our FPRL1 antibodies are polyclonal and would detect both mouse and human formyl peptide receptor-like-1 and we do not have any mouse monoclonal antibody for it.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...

Associated Pathways

A-beta Pathways: Uptake & Degradation
A-beta Pathways: Uptake & Degradation Thumbnail